diff options
Diffstat (limited to 'vendor/golang.org/x/text/language')
-rw-r--r-- | vendor/golang.org/x/text/language/Makefile | 16 | ||||
-rw-r--r-- | vendor/golang.org/x/text/language/common.go | 16 | ||||
-rw-r--r-- | vendor/golang.org/x/text/language/coverage.go | 197 | ||||
-rw-r--r-- | vendor/golang.org/x/text/language/doc.go | 102 | ||||
-rw-r--r-- | vendor/golang.org/x/text/language/gen.go | 1706 | ||||
-rw-r--r-- | vendor/golang.org/x/text/language/gen_common.go | 20 | ||||
-rw-r--r-- | vendor/golang.org/x/text/language/gen_index.go | 162 | ||||
-rw-r--r-- | vendor/golang.org/x/text/language/go1_1.go | 38 | ||||
-rw-r--r-- | vendor/golang.org/x/text/language/go1_2.go | 11 | ||||
-rw-r--r-- | vendor/golang.org/x/text/language/index.go | 769 | ||||
-rw-r--r-- | vendor/golang.org/x/text/language/language.go | 887 | ||||
-rw-r--r-- | vendor/golang.org/x/text/language/lookup.go | 396 | ||||
-rw-r--r-- | vendor/golang.org/x/text/language/match.go | 933 | ||||
-rw-r--r-- | vendor/golang.org/x/text/language/parse.go | 859 | ||||
-rw-r--r-- | vendor/golang.org/x/text/language/tables.go | 3675 | ||||
-rw-r--r-- | vendor/golang.org/x/text/language/tags.go | 143 |
16 files changed, 0 insertions, 9930 deletions
diff --git a/vendor/golang.org/x/text/language/Makefile b/vendor/golang.org/x/text/language/Makefile deleted file mode 100644 index 79f0057..0000000 --- a/vendor/golang.org/x/text/language/Makefile +++ /dev/null @@ -1,16 +0,0 @@ -# Copyright 2013 The Go Authors. All rights reserved. -# Use of this source code is governed by a BSD-style -# license that can be found in the LICENSE file. - -CLEANFILES+=maketables - -maketables: maketables.go - go build $^ - -tables: maketables - ./maketables > tables.go - gofmt -w -s tables.go - -# Build (but do not run) maketables during testing, -# just to make sure it still compiles. -testshort: maketables diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/language/common.go deleted file mode 100644 index 9d86e18..0000000 --- a/vendor/golang.org/x/text/language/common.go +++ /dev/null @@ -1,16 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -// This file contains code common to the maketables.go and the package code. - -// langAliasType is the type of an alias in langAliasMap. -type langAliasType int8 - -const ( - langDeprecated langAliasType = iota - langMacro - langLegacy - - langAliasTypeUnknown langAliasType = -1 -) diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go deleted file mode 100644 index 101fd23..0000000 --- a/vendor/golang.org/x/text/language/coverage.go +++ /dev/null @@ -1,197 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "fmt" - "sort" -) - -// The Coverage interface is used to define the level of coverage of an -// internationalization service. Note that not all types are supported by all -// services. As lists may be generated on the fly, it is recommended that users -// of a Coverage cache the results. -type Coverage interface { - // Tags returns the list of supported tags. - Tags() []Tag - - // BaseLanguages returns the list of supported base languages. - BaseLanguages() []Base - - // Scripts returns the list of supported scripts. - Scripts() []Script - - // Regions returns the list of supported regions. - Regions() []Region -} - -var ( - // Supported defines a Coverage that lists all supported subtags. Tags - // always returns nil. - Supported Coverage = allSubtags{} -) - -// TODO: -// - Support Variants, numbering systems. -// - CLDR coverage levels. -// - Set of common tags defined in this package. - -type allSubtags struct{} - -// Regions returns the list of supported regions. As all regions are in a -// consecutive range, it simply returns a slice of numbers in increasing order. -// The "undefined" region is not returned. -func (s allSubtags) Regions() []Region { - reg := make([]Region, numRegions) - for i := range reg { - reg[i] = Region{regionID(i + 1)} - } - return reg -} - -// Scripts returns the list of supported scripts. As all scripts are in a -// consecutive range, it simply returns a slice of numbers in increasing order. -// The "undefined" script is not returned. -func (s allSubtags) Scripts() []Script { - scr := make([]Script, numScripts) - for i := range scr { - scr[i] = Script{scriptID(i + 1)} - } - return scr -} - -// BaseLanguages returns the list of all supported base languages. It generates -// the list by traversing the internal structures. -func (s allSubtags) BaseLanguages() []Base { - base := make([]Base, 0, numLanguages) - for i := 0; i < langNoIndexOffset; i++ { - // We included "und" already for the value 0. - if i != nonCanonicalUnd { - base = append(base, Base{langID(i)}) - } - } - i := langNoIndexOffset - for _, v := range langNoIndex { - for k := 0; k < 8; k++ { - if v&1 == 1 { - base = append(base, Base{langID(i)}) - } - v >>= 1 - i++ - } - } - return base -} - -// Tags always returns nil. -func (s allSubtags) Tags() []Tag { - return nil -} - -// coverage is used used by NewCoverage which is used as a convenient way for -// creating Coverage implementations for partially defined data. Very often a -// package will only need to define a subset of slices. coverage provides a -// convenient way to do this. Moreover, packages using NewCoverage, instead of -// their own implementation, will not break if later new slice types are added. -type coverage struct { - tags func() []Tag - bases func() []Base - scripts func() []Script - regions func() []Region -} - -func (s *coverage) Tags() []Tag { - if s.tags == nil { - return nil - } - return s.tags() -} - -// bases implements sort.Interface and is used to sort base languages. -type bases []Base - -func (b bases) Len() int { - return len(b) -} - -func (b bases) Swap(i, j int) { - b[i], b[j] = b[j], b[i] -} - -func (b bases) Less(i, j int) bool { - return b[i].langID < b[j].langID -} - -// BaseLanguages returns the result from calling s.bases if it is specified or -// otherwise derives the set of supported base languages from tags. -func (s *coverage) BaseLanguages() []Base { - if s.bases == nil { - tags := s.Tags() - if len(tags) == 0 { - return nil - } - a := make([]Base, len(tags)) - for i, t := range tags { - a[i] = Base{langID(t.lang)} - } - sort.Sort(bases(a)) - k := 0 - for i := 1; i < len(a); i++ { - if a[k] != a[i] { - k++ - a[k] = a[i] - } - } - return a[:k+1] - } - return s.bases() -} - -func (s *coverage) Scripts() []Script { - if s.scripts == nil { - return nil - } - return s.scripts() -} - -func (s *coverage) Regions() []Region { - if s.regions == nil { - return nil - } - return s.regions() -} - -// NewCoverage returns a Coverage for the given lists. It is typically used by -// packages providing internationalization services to define their level of -// coverage. A list may be of type []T or func() []T, where T is either Tag, -// Base, Script or Region. The returned Coverage derives the value for Bases -// from Tags if no func or slice for []Base is specified. For other unspecified -// types the returned Coverage will return nil for the respective methods. -func NewCoverage(list ...interface{}) Coverage { - s := &coverage{} - for _, x := range list { - switch v := x.(type) { - case func() []Base: - s.bases = v - case func() []Script: - s.scripts = v - case func() []Region: - s.regions = v - case func() []Tag: - s.tags = v - case []Base: - s.bases = func() []Base { return v } - case []Script: - s.scripts = func() []Script { return v } - case []Region: - s.regions = func() []Region { return v } - case []Tag: - s.tags = func() []Tag { return v } - default: - panic(fmt.Sprintf("language: unsupported set type %T", v)) - } - } - return s -} diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go deleted file mode 100644 index 8afecd5..0000000 --- a/vendor/golang.org/x/text/language/doc.go +++ /dev/null @@ -1,102 +0,0 @@ -// Copyright 2017 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package language implements BCP 47 language tags and related functionality. -// -// The most important function of package language is to match a list of -// user-preferred languages to a list of supported languages. -// It alleviates the developer of dealing with the complexity of this process -// and provides the user with the best experience -// (see https://blog.golang.org/matchlang). -// -// -// Matching preferred against supported languages -// -// A Matcher for an application that supports English, Australian English, -// Danish, and standard Mandarin can be created as follows: -// -// var matcher = language.NewMatcher([]language.Tag{ -// language.English, // The first language is used as fallback. -// language.MustParse("en-AU"), -// language.Danish, -// language.Chinese, -// }) -// -// This list of supported languages is typically implied by the languages for -// which there exists translations of the user interface. -// -// User-preferred languages usually come as a comma-separated list of BCP 47 -// language tags. -// The MatchString finds best matches for such strings: -// -// handler(w http.ResponseWriter, r *http.Request) { -// lang, _ := r.Cookie("lang") -// accept := r.Header.Get("Accept-Language") -// tag, _ := language.MatchStrings(matcher, lang.String(), accept) -// -// // tag should now be used for the initialization of any -// // locale-specific service. -// } -// -// The Matcher's Match method can be used to match Tags directly. -// -// Matchers are aware of the intricacies of equivalence between languages, such -// as deprecated subtags, legacy tags, macro languages, mutual -// intelligibility between scripts and languages, and transparently passing -// BCP 47 user configuration. -// For instance, it will know that a reader of BokmÃ¥l Danish can read Norwegian -// and will know that Cantonese ("yue") is a good match for "zh-HK". -// -// -// Using match results -// -// To guarantee a consistent user experience to the user it is important to -// use the same language tag for the selection of any locale-specific services. -// For example, it is utterly confusing to substitute spelled-out numbers -// or dates in one language in text of another language. -// More subtly confusing is using the wrong sorting order or casing -// algorithm for a certain language. -// -// All the packages in x/text that provide locale-specific services -// (e.g. collate, cases) should be initialized with the tag that was -// obtained at the start of an interaction with the user. -// -// Note that Tag that is returned by Match and MatchString may differ from any -// of the supported languages, as it may contain carried over settings from -// the user tags. -// This may be inconvenient when your application has some additional -// locale-specific data for your supported languages. -// Match and MatchString both return the index of the matched supported tag -// to simplify associating such data with the matched tag. -// -// -// Canonicalization -// -// If one uses the Matcher to compare languages one does not need to -// worry about canonicalization. -// -// The meaning of a Tag varies per application. The language package -// therefore delays canonicalization and preserves information as much -// as possible. The Matcher, however, will always take into account that -// two different tags may represent the same language. -// -// By default, only legacy and deprecated tags are converted into their -// canonical equivalent. All other information is preserved. This approach makes -// the confidence scores more accurate and allows matchers to distinguish -// between variants that are otherwise lost. -// -// As a consequence, two tags that should be treated as identical according to -// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The -// Matcher handles such distinctions, though, and is aware of the -// equivalence relations. The CanonType type can be used to alter the -// canonicalization form. -// -// References -// -// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47 -// -package language // import "golang.org/x/text/language" - -// TODO: explanation on how to match languages for your own locale-specific -// service. diff --git a/vendor/golang.org/x/text/language/gen.go b/vendor/golang.org/x/text/language/gen.go deleted file mode 100644 index 7c260e5..0000000 --- a/vendor/golang.org/x/text/language/gen.go +++ /dev/null @@ -1,1706 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -// Language tag table generator. -// Data read from the web. - -package main - -import ( - "bufio" - "flag" - "fmt" - "io" - "io/ioutil" - "log" - "math" - "reflect" - "regexp" - "sort" - "strconv" - "strings" - - "golang.org/x/text/internal/gen" - "golang.org/x/text/internal/tag" - "golang.org/x/text/unicode/cldr" -) - -var ( - test = flag.Bool("test", - false, - "test existing tables; can be used to compare web data with package data.") - outputFile = flag.String("output", - "tables.go", - "output file for generated tables") -) - -var comment = []string{ - ` -lang holds an alphabetically sorted list of ISO-639 language identifiers. -All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. -For 2-byte language identifiers, the two successive bytes have the following meaning: - - if the first letter of the 2- and 3-letter ISO codes are the same: - the second and third letter of the 3-letter ISO code. - - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. -For 3-byte language identifiers the 4th byte is 0.`, - ` -langNoIndex is a bit vector of all 3-letter language codes that are not used as an index -in lookup tables. The language ids for these language codes are derived directly -from the letters and are not consecutive.`, - ` -altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives -to 2-letter language codes that cannot be derived using the method described above. -Each 3-letter code is followed by its 1-byte langID.`, - ` -altLangIndex is used to convert indexes in altLangISO3 to langIDs.`, - ` -langAliasMap maps langIDs to their suggested replacements.`, - ` -script is an alphabetically sorted list of ISO 15924 codes. The index -of the script in the string, divided by 4, is the internal scriptID.`, - ` -isoRegionOffset needs to be added to the index of regionISO to obtain the regionID -for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for -the UN.M49 codes used for groups.)`, - ` -regionISO holds a list of alphabetically sorted 2-letter ISO region codes. -Each 2-letter codes is followed by two bytes with the following meaning: - - [A-Z}{2}: the first letter of the 2-letter code plus these two - letters form the 3-letter ISO code. - - 0, n: index into altRegionISO3.`, - ` -regionTypes defines the status of a region for various standards.`, - ` -m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are -codes indicating collections of regions.`, - ` -m49Index gives indexes into fromM49 based on the three most significant bits -of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in - fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] -for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. -The region code is stored in the 9 lsb of the indexed value.`, - ` -fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`, - ` -altRegionISO3 holds a list of 3-letter region codes that cannot be -mapped to 2-letter codes using the default algorithm. This is a short list.`, - ` -altRegionIDs holds a list of regionIDs the positions of which match those -of the 3-letter ISO codes in altRegionISO3.`, - ` -variantNumSpecialized is the number of specialized variants in variants.`, - ` -suppressScript is an index from langID to the dominant script for that language, -if it exists. If a script is given, it should be suppressed from the language tag.`, - ` -likelyLang is a lookup table, indexed by langID, for the most likely -scripts and regions given incomplete information. If more entries exist for a -given language, region and script are the index and size respectively -of the list in likelyLangList.`, - ` -likelyLangList holds lists info associated with likelyLang.`, - ` -likelyRegion is a lookup table, indexed by regionID, for the most likely -languages and scripts given incomplete information. If more entries exist -for a given regionID, lang and script are the index and size respectively -of the list in likelyRegionList. -TODO: exclude containers and user-definable regions from the list.`, - ` -likelyRegionList holds lists info associated with likelyRegion.`, - ` -likelyScript is a lookup table, indexed by scriptID, for the most likely -languages and regions given a script.`, - ` -matchLang holds pairs of langIDs of base languages that are typically -mutually intelligible. Each pair is associated with a confidence and -whether the intelligibility goes one or both ways.`, - ` -matchScript holds pairs of scriptIDs where readers of one script -can typically also read the other. Each is associated with a confidence.`, - ` -nRegionGroups is the number of region groups.`, - ` -regionInclusion maps region identifiers to sets of regions in regionInclusionBits, -where each set holds all groupings that are directly connected in a region -containment graph.`, - ` -regionInclusionBits is an array of bit vectors where every vector represents -a set of region groupings. These sets are used to compute the distance -between two regions for the purpose of language matching.`, - ` -regionInclusionNext marks, for each entry in regionInclusionBits, the set of -all groups that are reachable from the groups set in the respective entry.`, -} - -// TODO: consider changing some of these structures to tries. This can reduce -// memory, but may increase the need for memory allocations. This could be -// mitigated if we can piggyback on language tags for common cases. - -func failOnError(e error) { - if e != nil { - log.Panic(e) - } -} - -type setType int - -const ( - Indexed setType = 1 + iota // all elements must be of same size - Linear -) - -type stringSet struct { - s []string - sorted, frozen bool - - // We often need to update values after the creation of an index is completed. - // We include a convenience map for keeping track of this. - update map[string]string - typ setType // used for checking. -} - -func (ss *stringSet) clone() stringSet { - c := *ss - c.s = append([]string(nil), c.s...) - return c -} - -func (ss *stringSet) setType(t setType) { - if ss.typ != t && ss.typ != 0 { - log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ) - } -} - -// parse parses a whitespace-separated string and initializes ss with its -// components. -func (ss *stringSet) parse(s string) { - scan := bufio.NewScanner(strings.NewReader(s)) - scan.Split(bufio.ScanWords) - for scan.Scan() { - ss.add(scan.Text()) - } -} - -func (ss *stringSet) assertChangeable() { - if ss.frozen { - log.Panic("attempt to modify a frozen stringSet") - } -} - -func (ss *stringSet) add(s string) { - ss.assertChangeable() - ss.s = append(ss.s, s) - ss.sorted = ss.frozen -} - -func (ss *stringSet) freeze() { - ss.compact() - ss.frozen = true -} - -func (ss *stringSet) compact() { - if ss.sorted { - return - } - a := ss.s - sort.Strings(a) - k := 0 - for i := 1; i < len(a); i++ { - if a[k] != a[i] { - a[k+1] = a[i] - k++ - } - } - ss.s = a[:k+1] - ss.sorted = ss.frozen -} - -type funcSorter struct { - fn func(a, b string) bool - sort.StringSlice -} - -func (s funcSorter) Less(i, j int) bool { - return s.fn(s.StringSlice[i], s.StringSlice[j]) -} - -func (ss *stringSet) sortFunc(f func(a, b string) bool) { - ss.compact() - sort.Sort(funcSorter{f, sort.StringSlice(ss.s)}) -} - -func (ss *stringSet) remove(s string) { - ss.assertChangeable() - if i, ok := ss.find(s); ok { - copy(ss.s[i:], ss.s[i+1:]) - ss.s = ss.s[:len(ss.s)-1] - } -} - -func (ss *stringSet) replace(ol, nu string) { - ss.s[ss.index(ol)] = nu - ss.sorted = ss.frozen -} - -func (ss *stringSet) index(s string) int { - ss.setType(Indexed) - i, ok := ss.find(s) - if !ok { - if i < len(ss.s) { - log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i]) - } - log.Panicf("find: item %q is not in list", s) - - } - return i -} - -func (ss *stringSet) find(s string) (int, bool) { - ss.compact() - i := sort.SearchStrings(ss.s, s) - return i, i != len(ss.s) && ss.s[i] == s -} - -func (ss *stringSet) slice() []string { - ss.compact() - return ss.s -} - -func (ss *stringSet) updateLater(v, key string) { - if ss.update == nil { - ss.update = map[string]string{} - } - ss.update[v] = key -} - -// join joins the string and ensures that all entries are of the same length. -func (ss *stringSet) join() string { - ss.setType(Indexed) - n := len(ss.s[0]) - for _, s := range ss.s { - if len(s) != n { - log.Panicf("join: not all entries are of the same length: %q", s) - } - } - ss.s = append(ss.s, strings.Repeat("\xff", n)) - return strings.Join(ss.s, "") -} - -// ianaEntry holds information for an entry in the IANA Language Subtag Repository. -// All types use the same entry. -// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various -// fields. -type ianaEntry struct { - typ string - description []string - scope string - added string - preferred string - deprecated string - suppressScript string - macro string - prefix []string -} - -type builder struct { - w *gen.CodeWriter - hw io.Writer // MultiWriter for w and w.Hash - data *cldr.CLDR - supp *cldr.SupplementalData - - // indices - locale stringSet // common locales - lang stringSet // canonical language ids (2 or 3 letter ISO codes) with data - langNoIndex stringSet // 3-letter ISO codes with no associated data - script stringSet // 4-letter ISO codes - region stringSet // 2-letter ISO or 3-digit UN M49 codes - variant stringSet // 4-8-alphanumeric variant code. - - // Region codes that are groups with their corresponding group IDs. - groups map[int]index - - // langInfo - registry map[string]*ianaEntry -} - -type index uint - -func newBuilder(w *gen.CodeWriter) *builder { - r := gen.OpenCLDRCoreZip() - defer r.Close() - d := &cldr.Decoder{} - data, err := d.DecodeZip(r) - failOnError(err) - b := builder{ - w: w, - hw: io.MultiWriter(w, w.Hash), - data: data, - supp: data.Supplemental(), - } - b.parseRegistry() - return &b -} - -func (b *builder) parseRegistry() { - r := gen.OpenIANAFile("assignments/language-subtag-registry") - defer r.Close() - b.registry = make(map[string]*ianaEntry) - - scan := bufio.NewScanner(r) - scan.Split(bufio.ScanWords) - var record *ianaEntry - for more := scan.Scan(); more; { - key := scan.Text() - more = scan.Scan() - value := scan.Text() - switch key { - case "Type:": - record = &ianaEntry{typ: value} - case "Subtag:", "Tag:": - if s := strings.SplitN(value, "..", 2); len(s) > 1 { - for a := s[0]; a <= s[1]; a = inc(a) { - b.addToRegistry(a, record) - } - } else { - b.addToRegistry(value, record) - } - case "Suppress-Script:": - record.suppressScript = value - case "Added:": - record.added = value - case "Deprecated:": - record.deprecated = value - case "Macrolanguage:": - record.macro = value - case "Preferred-Value:": - record.preferred = value - case "Prefix:": - record.prefix = append(record.prefix, value) - case "Scope:": - record.scope = value - case "Description:": - buf := []byte(value) - for more = scan.Scan(); more; more = scan.Scan() { - b := scan.Bytes() - if b[0] == '%' || b[len(b)-1] == ':' { - break - } - buf = append(buf, ' ') - buf = append(buf, b...) - } - record.description = append(record.description, string(buf)) - continue - default: - continue - } - more = scan.Scan() - } - if scan.Err() != nil { - log.Panic(scan.Err()) - } -} - -func (b *builder) addToRegistry(key string, entry *ianaEntry) { - if info, ok := b.registry[key]; ok { - if info.typ != "language" || entry.typ != "extlang" { - log.Fatalf("parseRegistry: tag %q already exists", key) - } - } else { - b.registry[key] = entry - } -} - -var commentIndex = make(map[string]string) - -func init() { - for _, s := range comment { - key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0]) - commentIndex[key] = s - } -} - -func (b *builder) comment(name string) { - if s := commentIndex[name]; len(s) > 0 { - b.w.WriteComment(s) - } else { - fmt.Fprintln(b.w) - } -} - -func (b *builder) pf(f string, x ...interface{}) { - fmt.Fprintf(b.hw, f, x...) - fmt.Fprint(b.hw, "\n") -} - -func (b *builder) p(x ...interface{}) { - fmt.Fprintln(b.hw, x...) -} - -func (b *builder) addSize(s int) { - b.w.Size += s - b.pf("// Size: %d bytes", s) -} - -func (b *builder) writeConst(name string, x interface{}) { - b.comment(name) - b.w.WriteConst(name, x) -} - -// writeConsts computes f(v) for all v in values and writes the results -// as constants named _v to a single constant block. -func (b *builder) writeConsts(f func(string) int, values ...string) { - b.pf("const (") - for _, v := range values { - b.pf("\t_%s = %v", v, f(v)) - } - b.pf(")") -} - -// writeType writes the type of the given value, which must be a struct. -func (b *builder) writeType(value interface{}) { - b.comment(reflect.TypeOf(value).Name()) - b.w.WriteType(value) -} - -func (b *builder) writeSlice(name string, ss interface{}) { - b.writeSliceAddSize(name, 0, ss) -} - -func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) { - b.comment(name) - b.w.Size += extraSize - v := reflect.ValueOf(ss) - t := v.Type().Elem() - b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len()) - - fmt.Fprintf(b.w, "var %s = ", name) - b.w.WriteArray(ss) - b.p() -} - -type fromTo struct { - from, to uint16 -} - -func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) { - ss.sortFunc(func(a, b string) bool { - return index(a) < index(b) - }) - m := []fromTo{} - for _, s := range ss.s { - m = append(m, fromTo{index(s), index(ss.update[s])}) - } - b.writeSlice(name, m) -} - -const base = 'z' - 'a' + 1 - -func strToInt(s string) uint { - v := uint(0) - for i := 0; i < len(s); i++ { - v *= base - v += uint(s[i] - 'a') - } - return v -} - -// converts the given integer to the original ASCII string passed to strToInt. -// len(s) must match the number of characters obtained. -func intToStr(v uint, s []byte) { - for i := len(s) - 1; i >= 0; i-- { - s[i] = byte(v%base) + 'a' - v /= base - } -} - -func (b *builder) writeBitVector(name string, ss []string) { - vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8))) - for _, s := range ss { - v := strToInt(s) - vec[v/8] |= 1 << (v % 8) - } - b.writeSlice(name, vec) -} - -// TODO: convert this type into a list or two-stage trie. -func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) { - b.comment(name) - v := reflect.ValueOf(m) - sz := v.Len() * (2 + int(v.Type().Key().Size())) - for _, k := range m { - sz += len(k) - } - b.addSize(sz) - keys := []string{} - b.pf(`var %s = map[string]uint16{`, name) - for k := range m { - keys = append(keys, k) - } - sort.Strings(keys) - for _, k := range keys { - b.pf("\t%q: %v,", k, f(m[k])) - } - b.p("}") -} - -func (b *builder) writeMap(name string, m interface{}) { - b.comment(name) - v := reflect.ValueOf(m) - sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size())) - b.addSize(sz) - f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool { - return strings.IndexRune("{}, ", r) != -1 - }) - sort.Strings(f[1:]) - b.pf(`var %s = %s{`, name, f[0]) - for _, kv := range f[1:] { - b.pf("\t%s,", kv) - } - b.p("}") -} - -func (b *builder) langIndex(s string) uint16 { - if s == "und" { - return 0 - } - if i, ok := b.lang.find(s); ok { - return uint16(i) - } - return uint16(strToInt(s)) + uint16(len(b.lang.s)) -} - -// inc advances the string to its lexicographical successor. -func inc(s string) string { - const maxTagLength = 4 - var buf [maxTagLength]byte - intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)]) - for i := 0; i < len(s); i++ { - if s[i] <= 'Z' { - buf[i] -= 'a' - 'A' - } - } - return string(buf[:len(s)]) -} - -func (b *builder) parseIndices() { - meta := b.supp.Metadata - - for k, v := range b.registry { - var ss *stringSet - switch v.typ { - case "language": - if len(k) == 2 || v.suppressScript != "" || v.scope == "special" { - b.lang.add(k) - continue - } else { - ss = &b.langNoIndex - } - case "region": - ss = &b.region - case "script": - ss = &b.script - case "variant": - ss = &b.variant - default: - continue - } - ss.add(k) - } - // Include any language for which there is data. - for _, lang := range b.data.Locales() { - if x := b.data.RawLDML(lang); false || - x.LocaleDisplayNames != nil || - x.Characters != nil || - x.Delimiters != nil || - x.Measurement != nil || - x.Dates != nil || - x.Numbers != nil || - x.Units != nil || - x.ListPatterns != nil || - x.Collations != nil || - x.Segmentations != nil || - x.Rbnf != nil || - x.Annotations != nil || - x.Metadata != nil { - - from := strings.Split(lang, "_") - if lang := from[0]; lang != "root" { - b.lang.add(lang) - } - } - } - // Include locales for plural rules, which uses a different structure. - for _, plurals := range b.data.Supplemental().Plurals { - for _, rules := range plurals.PluralRules { - for _, lang := range strings.Split(rules.Locales, " ") { - if lang = strings.Split(lang, "_")[0]; lang != "root" { - b.lang.add(lang) - } - } - } - } - // Include languages in likely subtags. - for _, m := range b.supp.LikelySubtags.LikelySubtag { - from := strings.Split(m.From, "_") - b.lang.add(from[0]) - } - // Include ISO-639 alpha-3 bibliographic entries. - for _, a := range meta.Alias.LanguageAlias { - if a.Reason == "bibliographic" { - b.langNoIndex.add(a.Type) - } - } - // Include regions in territoryAlias (not all are in the IANA registry!) - for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { - if len(reg.Type) == 2 { - b.region.add(reg.Type) - } - } - - for _, s := range b.lang.s { - if len(s) == 3 { - b.langNoIndex.remove(s) - } - } - b.writeConst("numLanguages", len(b.lang.slice())+len(b.langNoIndex.slice())) - b.writeConst("numScripts", len(b.script.slice())) - b.writeConst("numRegions", len(b.region.slice())) - - // Add dummy codes at the start of each list to represent "unspecified". - b.lang.add("---") - b.script.add("----") - b.region.add("---") - - // common locales - b.locale.parse(meta.DefaultContent.Locales) -} - -// TODO: region inclusion data will probably not be use used in future matchers. - -func (b *builder) computeRegionGroups() { - b.groups = make(map[int]index) - - // Create group indices. - for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID. - b.groups[i] = index(len(b.groups)) - } - for _, g := range b.supp.TerritoryContainment.Group { - // Skip UN and EURO zone as they are flattening the containment - // relationship. - if g.Type == "EZ" || g.Type == "UN" { - continue - } - group := b.region.index(g.Type) - if _, ok := b.groups[group]; !ok { - b.groups[group] = index(len(b.groups)) - } - } - if len(b.groups) > 64 { - log.Fatalf("only 64 groups supported, found %d", len(b.groups)) - } - b.writeConst("nRegionGroups", len(b.groups)) -} - -var langConsts = []string{ - "af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es", - "et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is", - "it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml", - "mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt", - "ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th", - "tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu", - - // constants for grandfathered tags (if not already defined) - "jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu", - "nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn", -} - -// writeLanguage generates all tables needed for language canonicalization. -func (b *builder) writeLanguage() { - meta := b.supp.Metadata - - b.writeConst("nonCanonicalUnd", b.lang.index("und")) - b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...) - b.writeConst("langPrivateStart", b.langIndex("qaa")) - b.writeConst("langPrivateEnd", b.langIndex("qtz")) - - // Get language codes that need to be mapped (overlong 3-letter codes, - // deprecated 2-letter codes, legacy and grandfathered tags.) - langAliasMap := stringSet{} - aliasTypeMap := map[string]langAliasType{} - - // altLangISO3 get the alternative ISO3 names that need to be mapped. - altLangISO3 := stringSet{} - // Add dummy start to avoid the use of index 0. - altLangISO3.add("---") - altLangISO3.updateLater("---", "aa") - - lang := b.lang.clone() - for _, a := range meta.Alias.LanguageAlias { - if a.Replacement == "" { - a.Replacement = "und" - } - // TODO: support mapping to tags - repl := strings.SplitN(a.Replacement, "_", 2)[0] - if a.Reason == "overlong" { - if len(a.Replacement) == 2 && len(a.Type) == 3 { - lang.updateLater(a.Replacement, a.Type) - } - } else if len(a.Type) <= 3 { - switch a.Reason { - case "macrolanguage": - aliasTypeMap[a.Type] = langMacro - case "deprecated": - // handled elsewhere - continue - case "bibliographic", "legacy": - if a.Type == "no" { - continue - } - aliasTypeMap[a.Type] = langLegacy - default: - log.Fatalf("new %s alias: %s", a.Reason, a.Type) - } - langAliasMap.add(a.Type) - langAliasMap.updateLater(a.Type, repl) - } - } - // Manually add the mapping of "nb" (Norwegian) to its macro language. - // This can be removed if CLDR adopts this change. - langAliasMap.add("nb") - langAliasMap.updateLater("nb", "no") - aliasTypeMap["nb"] = langMacro - - for k, v := range b.registry { - // Also add deprecated values for 3-letter ISO codes, which CLDR omits. - if v.typ == "language" && v.deprecated != "" && v.preferred != "" { - langAliasMap.add(k) - langAliasMap.updateLater(k, v.preferred) - aliasTypeMap[k] = langDeprecated - } - } - // Fix CLDR mappings. - lang.updateLater("tl", "tgl") - lang.updateLater("sh", "hbs") - lang.updateLater("mo", "mol") - lang.updateLater("no", "nor") - lang.updateLater("tw", "twi") - lang.updateLater("nb", "nob") - lang.updateLater("ak", "aka") - lang.updateLater("bh", "bih") - - // Ensure that each 2-letter code is matched with a 3-letter code. - for _, v := range lang.s[1:] { - s, ok := lang.update[v] - if !ok { - if s, ok = lang.update[langAliasMap.update[v]]; !ok { - continue - } - lang.update[v] = s - } - if v[0] != s[0] { - altLangISO3.add(s) - altLangISO3.updateLater(s, v) - } - } - - // Complete canonicalized language tags. - lang.freeze() - for i, v := range lang.s { - // We can avoid these manual entries by using the IANA registry directly. - // Seems easier to update the list manually, as changes are rare. - // The panic in this loop will trigger if we miss an entry. - add := "" - if s, ok := lang.update[v]; ok { - if s[0] == v[0] { - add = s[1:] - } else { - add = string([]byte{0, byte(altLangISO3.index(s))}) - } - } else if len(v) == 3 { - add = "\x00" - } else { - log.Panicf("no data for long form of %q", v) - } - lang.s[i] += add - } - b.writeConst("lang", tag.Index(lang.join())) - - b.writeConst("langNoIndexOffset", len(b.lang.s)) - - // space of all valid 3-letter language identifiers. - b.writeBitVector("langNoIndex", b.langNoIndex.slice()) - - altLangIndex := []uint16{} - for i, s := range altLangISO3.slice() { - altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))}) - if i > 0 { - idx := b.lang.index(altLangISO3.update[s]) - altLangIndex = append(altLangIndex, uint16(idx)) - } - } - b.writeConst("altLangISO3", tag.Index(altLangISO3.join())) - b.writeSlice("altLangIndex", altLangIndex) - - b.writeSortedMap("langAliasMap", &langAliasMap, b.langIndex) - types := make([]langAliasType, len(langAliasMap.s)) - for i, s := range langAliasMap.s { - types[i] = aliasTypeMap[s] - } - b.writeSlice("langAliasTypes", types) -} - -var scriptConsts = []string{ - "Latn", "Hani", "Hans", "Hant", "Qaaa", "Qaai", "Qabx", "Zinh", "Zyyy", - "Zzzz", -} - -func (b *builder) writeScript() { - b.writeConsts(b.script.index, scriptConsts...) - b.writeConst("script", tag.Index(b.script.join())) - - supp := make([]uint8, len(b.lang.slice())) - for i, v := range b.lang.slice()[1:] { - if sc := b.registry[v].suppressScript; sc != "" { - supp[i+1] = uint8(b.script.index(sc)) - } - } - b.writeSlice("suppressScript", supp) - - // There is only one deprecated script in CLDR. This value is hard-coded. - // We check here if the code must be updated. - for _, a := range b.supp.Metadata.Alias.ScriptAlias { - if a.Type != "Qaai" { - log.Panicf("unexpected deprecated stript %q", a.Type) - } - } -} - -func parseM49(s string) int16 { - if len(s) == 0 { - return 0 - } - v, err := strconv.ParseUint(s, 10, 10) - failOnError(err) - return int16(v) -} - -var regionConsts = []string{ - "001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US", - "ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo. -} - -func (b *builder) writeRegion() { - b.writeConsts(b.region.index, regionConsts...) - - isoOffset := b.region.index("AA") - m49map := make([]int16, len(b.region.slice())) - fromM49map := make(map[int16]int) - altRegionISO3 := "" - altRegionIDs := []uint16{} - - b.writeConst("isoRegionOffset", isoOffset) - - // 2-letter region lookup and mapping to numeric codes. - regionISO := b.region.clone() - regionISO.s = regionISO.s[isoOffset:] - regionISO.sorted = false - - regionTypes := make([]byte, len(b.region.s)) - - // Is the region valid BCP 47? - for s, e := range b.registry { - if len(s) == 2 && s == strings.ToUpper(s) { - i := b.region.index(s) - for _, d := range e.description { - if strings.Contains(d, "Private use") { - regionTypes[i] = iso3166UserAssigned - } - } - regionTypes[i] |= bcp47Region - } - } - - // Is the region a valid ccTLD? - r := gen.OpenIANAFile("domains/root/db") - defer r.Close() - - buf, err := ioutil.ReadAll(r) - failOnError(err) - re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`) - for _, m := range re.FindAllSubmatch(buf, -1) { - i := b.region.index(strings.ToUpper(string(m[1]))) - regionTypes[i] |= ccTLD - } - - b.writeSlice("regionTypes", regionTypes) - - iso3Set := make(map[string]int) - update := func(iso2, iso3 string) { - i := regionISO.index(iso2) - if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] { - regionISO.s[i] += iso3[1:] - iso3Set[iso3] = -1 - } else { - if ok && j >= 0 { - regionISO.s[i] += string([]byte{0, byte(j)}) - } else { - iso3Set[iso3] = len(altRegionISO3) - regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))}) - altRegionISO3 += iso3 - altRegionIDs = append(altRegionIDs, uint16(isoOffset+i)) - } - } - } - for _, tc := range b.supp.CodeMappings.TerritoryCodes { - i := regionISO.index(tc.Type) + isoOffset - if d := m49map[i]; d != 0 { - log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d) - } - m49 := parseM49(tc.Numeric) - m49map[i] = m49 - if r := fromM49map[m49]; r == 0 { - fromM49map[m49] = i - } else if r != i { - dep := b.registry[regionISO.s[r-isoOffset]].deprecated - if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) { - fromM49map[m49] = i - } - } - } - for _, ta := range b.supp.Metadata.Alias.TerritoryAlias { - if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 { - from := parseM49(ta.Type) - if r := fromM49map[from]; r == 0 { - fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset - } - } - } - for _, tc := range b.supp.CodeMappings.TerritoryCodes { - if len(tc.Alpha3) == 3 { - update(tc.Type, tc.Alpha3) - } - } - // This entries are not included in territoryCodes. Mostly 3-letter variants - // of deleted codes and an entry for QU. - for _, m := range []struct{ iso2, iso3 string }{ - {"CT", "CTE"}, - {"DY", "DHY"}, - {"HV", "HVO"}, - {"JT", "JTN"}, - {"MI", "MID"}, - {"NH", "NHB"}, - {"NQ", "ATN"}, - {"PC", "PCI"}, - {"PU", "PUS"}, - {"PZ", "PCZ"}, - {"RH", "RHO"}, - {"VD", "VDR"}, - {"WK", "WAK"}, - // These three-letter codes are used for others as well. - {"FQ", "ATF"}, - } { - update(m.iso2, m.iso3) - } - for i, s := range regionISO.s { - if len(s) != 4 { - regionISO.s[i] = s + " " - } - } - b.writeConst("regionISO", tag.Index(regionISO.join())) - b.writeConst("altRegionISO3", altRegionISO3) - b.writeSlice("altRegionIDs", altRegionIDs) - - // Create list of deprecated regions. - // TODO: consider inserting SF -> FI. Not included by CLDR, but is the only - // Transitionally-reserved mapping not included. - regionOldMap := stringSet{} - // Include regions in territoryAlias (not all are in the IANA registry!) - for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { - if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 { - regionOldMap.add(reg.Type) - regionOldMap.updateLater(reg.Type, reg.Replacement) - i, _ := regionISO.find(reg.Type) - j, _ := regionISO.find(reg.Replacement) - if k := m49map[i+isoOffset]; k == 0 { - m49map[i+isoOffset] = m49map[j+isoOffset] - } - } - } - b.writeSortedMap("regionOldMap", ®ionOldMap, func(s string) uint16 { - return uint16(b.region.index(s)) - }) - // 3-digit region lookup, groupings. - for i := 1; i < isoOffset; i++ { - m := parseM49(b.region.s[i]) - m49map[i] = m - fromM49map[m] = i - } - b.writeSlice("m49", m49map) - - const ( - searchBits = 7 - regionBits = 9 - ) - if len(m49map) >= 1<<regionBits { - log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits) - } - m49Index := [9]int16{} - fromM49 := []uint16{} - m49 := []int{} - for k, _ := range fromM49map { - m49 = append(m49, int(k)) - } - sort.Ints(m49) - for _, k := range m49[1:] { - val := (k & (1<<searchBits - 1)) << regionBits - fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)])) - m49Index[1:][k>>searchBits] = int16(len(fromM49)) - } - b.writeSlice("m49Index", m49Index) - b.writeSlice("fromM49", fromM49) -} - -const ( - // TODO: put these lists in regionTypes as user data? Could be used for - // various optimizations and refinements and could be exposed in the API. - iso3166Except = "AC CP DG EA EU FX IC SU TA UK" - iso3166Trans = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions. - // DY and RH are actually not deleted, but indeterminately reserved. - iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD" -) - -const ( - iso3166UserAssigned = 1 << iota - ccTLD - bcp47Region -) - -func find(list []string, s string) int { - for i, t := range list { - if t == s { - return i - } - } - return -1 -} - -// writeVariants generates per-variant information and creates a map from variant -// name to index value. We assign index values such that sorting multiple -// variants by index value will result in the correct order. -// There are two types of variants: specialized and general. Specialized variants -// are only applicable to certain language or language-script pairs. Generalized -// variants apply to any language. Generalized variants always sort after -// specialized variants. We will therefore always assign a higher index value -// to a generalized variant than any other variant. Generalized variants are -// sorted alphabetically among themselves. -// Specialized variants may also sort after other specialized variants. Such -// variants will be ordered after any of the variants they may follow. -// We assume that if a variant x is followed by a variant y, then for any prefix -// p of x, p-x is a prefix of y. This allows us to order tags based on the -// maximum of the length of any of its prefixes. -// TODO: it is possible to define a set of Prefix values on variants such that -// a total order cannot be defined to the point that this algorithm breaks. -// In other words, we cannot guarantee the same order of variants for the -// future using the same algorithm or for non-compliant combinations of -// variants. For this reason, consider using simple alphabetic sorting -// of variants and ignore Prefix restrictions altogether. -func (b *builder) writeVariant() { - generalized := stringSet{} - specialized := stringSet{} - specializedExtend := stringSet{} - // Collate the variants by type and check assumptions. - for _, v := range b.variant.slice() { - e := b.registry[v] - if len(e.prefix) == 0 { - generalized.add(v) - continue - } - c := strings.Split(e.prefix[0], "-") - hasScriptOrRegion := false - if len(c) > 1 { - _, hasScriptOrRegion = b.script.find(c[1]) - if !hasScriptOrRegion { - _, hasScriptOrRegion = b.region.find(c[1]) - - } - } - if len(c) == 1 || len(c) == 2 && hasScriptOrRegion { - // Variant is preceded by a language. - specialized.add(v) - continue - } - // Variant is preceded by another variant. - specializedExtend.add(v) - prefix := c[0] + "-" - if hasScriptOrRegion { - prefix += c[1] - } - for _, p := range e.prefix { - // Verify that the prefix minus the last element is a prefix of the - // predecessor element. - i := strings.LastIndex(p, "-") - pred := b.registry[p[i+1:]] - if find(pred.prefix, p[:i]) < 0 { - log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v) - } - // The sorting used below does not work in the general case. It works - // if we assume that variants that may be followed by others only have - // prefixes of the same length. Verify this. - count := strings.Count(p[:i], "-") - for _, q := range pred.prefix { - if c := strings.Count(q, "-"); c != count { - log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count) - } - } - if !strings.HasPrefix(p, prefix) { - log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix) - } - } - } - - // Sort extended variants. - a := specializedExtend.s - less := func(v, w string) bool { - // Sort by the maximum number of elements. - maxCount := func(s string) (max int) { - for _, p := range b.registry[s].prefix { - if c := strings.Count(p, "-"); c > max { - max = c - } - } - return - } - if cv, cw := maxCount(v), maxCount(w); cv != cw { - return cv < cw - } - // Sort by name as tie breaker. - return v < w - } - sort.Sort(funcSorter{less, sort.StringSlice(a)}) - specializedExtend.frozen = true - - // Create index from variant name to index. - variantIndex := make(map[string]uint8) - add := func(s []string) { - for _, v := range s { - variantIndex[v] = uint8(len(variantIndex)) - } - } - add(specialized.slice()) - add(specializedExtend.s) - numSpecialized := len(variantIndex) - add(generalized.slice()) - if n := len(variantIndex); n > 255 { - log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n) - } - b.writeMap("variantIndex", variantIndex) - b.writeConst("variantNumSpecialized", numSpecialized) -} - -func (b *builder) writeLanguageInfo() { -} - -// writeLikelyData writes tables that are used both for finding parent relations and for -// language matching. Each entry contains additional bits to indicate the status of the -// data to know when it cannot be used for parent relations. -func (b *builder) writeLikelyData() { - const ( - isList = 1 << iota - scriptInFrom - regionInFrom - ) - type ( // generated types - likelyScriptRegion struct { - region uint16 - script uint8 - flags uint8 - } - likelyLangScript struct { - lang uint16 - script uint8 - flags uint8 - } - likelyLangRegion struct { - lang uint16 - region uint16 - } - // likelyTag is used for getting likely tags for group regions, where - // the likely region might be a region contained in the group. - likelyTag struct { - lang uint16 - region uint16 - script uint8 - } - ) - var ( // generated variables - likelyRegionGroup = make([]likelyTag, len(b.groups)) - likelyLang = make([]likelyScriptRegion, len(b.lang.s)) - likelyRegion = make([]likelyLangScript, len(b.region.s)) - likelyScript = make([]likelyLangRegion, len(b.script.s)) - likelyLangList = []likelyScriptRegion{} - likelyRegionList = []likelyLangScript{} - ) - type fromTo struct { - from, to []string - } - langToOther := map[int][]fromTo{} - regionToOther := map[int][]fromTo{} - for _, m := range b.supp.LikelySubtags.LikelySubtag { - from := strings.Split(m.From, "_") - to := strings.Split(m.To, "_") - if len(to) != 3 { - log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to)) - } - if len(from) > 3 { - log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from)) - } - if from[0] != to[0] && from[0] != "und" { - log.Fatalf("unexpected language change in expansion: %s -> %s", from, to) - } - if len(from) == 3 { - if from[2] != to[2] { - log.Fatalf("unexpected region change in expansion: %s -> %s", from, to) - } - if from[0] != "und" { - log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to) - } - } - if len(from) == 1 || from[0] != "und" { - id := 0 - if from[0] != "und" { - id = b.lang.index(from[0]) - } - langToOther[id] = append(langToOther[id], fromTo{from, to}) - } else if len(from) == 2 && len(from[1]) == 4 { - sid := b.script.index(from[1]) - likelyScript[sid].lang = uint16(b.langIndex(to[0])) - likelyScript[sid].region = uint16(b.region.index(to[2])) - } else { - r := b.region.index(from[len(from)-1]) - if id, ok := b.groups[r]; ok { - if from[0] != "und" { - log.Fatalf("region changed unexpectedly: %s -> %s", from, to) - } - likelyRegionGroup[id].lang = uint16(b.langIndex(to[0])) - likelyRegionGroup[id].script = uint8(b.script.index(to[1])) - likelyRegionGroup[id].region = uint16(b.region.index(to[2])) - } else { - regionToOther[r] = append(regionToOther[r], fromTo{from, to}) - } - } - } - b.writeType(likelyLangRegion{}) - b.writeSlice("likelyScript", likelyScript) - - for id := range b.lang.s { - list := langToOther[id] - if len(list) == 1 { - likelyLang[id].region = uint16(b.region.index(list[0].to[2])) - likelyLang[id].script = uint8(b.script.index(list[0].to[1])) - } else if len(list) > 1 { - likelyLang[id].flags = isList - likelyLang[id].region = uint16(len(likelyLangList)) - likelyLang[id].script = uint8(len(list)) - for _, x := range list { - flags := uint8(0) - if len(x.from) > 1 { - if x.from[1] == x.to[2] { - flags = regionInFrom - } else { - flags = scriptInFrom - } - } - likelyLangList = append(likelyLangList, likelyScriptRegion{ - region: uint16(b.region.index(x.to[2])), - script: uint8(b.script.index(x.to[1])), - flags: flags, - }) - } - } - } - // TODO: merge suppressScript data with this table. - b.writeType(likelyScriptRegion{}) - b.writeSlice("likelyLang", likelyLang) - b.writeSlice("likelyLangList", likelyLangList) - - for id := range b.region.s { - list := regionToOther[id] - if len(list) == 1 { - likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0])) - likelyRegion[id].script = uint8(b.script.index(list[0].to[1])) - if len(list[0].from) > 2 { - likelyRegion[id].flags = scriptInFrom - } - } else if len(list) > 1 { - likelyRegion[id].flags = isList - likelyRegion[id].lang = uint16(len(likelyRegionList)) - likelyRegion[id].script = uint8(len(list)) - for i, x := range list { - if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 { - log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i) - } - x := likelyLangScript{ - lang: uint16(b.langIndex(x.to[0])), - script: uint8(b.script.index(x.to[1])), - } - if len(list[0].from) > 2 { - x.flags = scriptInFrom - } - likelyRegionList = append(likelyRegionList, x) - } - } - } - b.writeType(likelyLangScript{}) - b.writeSlice("likelyRegion", likelyRegion) - b.writeSlice("likelyRegionList", likelyRegionList) - - b.writeType(likelyTag{}) - b.writeSlice("likelyRegionGroup", likelyRegionGroup) -} - -type mutualIntelligibility struct { - want, have uint16 - distance uint8 - oneway bool -} - -type scriptIntelligibility struct { - wantLang, haveLang uint16 - wantScript, haveScript uint8 - distance uint8 - // Always oneway -} - -type regionIntelligibility struct { - lang uint16 // compact language id - script uint8 // 0 means any - group uint8 // 0 means any; if bit 7 is set it means inverse - distance uint8 - // Always twoway. -} - -// writeMatchData writes tables with languages and scripts for which there is -// mutual intelligibility. The data is based on CLDR's languageMatching data. -// Note that we use a different algorithm than the one defined by CLDR and that -// we slightly modify the data. For example, we convert scores to confidence levels. -// We also drop all region-related data as we use a different algorithm to -// determine region equivalence. -func (b *builder) writeMatchData() { - lm := b.supp.LanguageMatching.LanguageMatches - cldr.MakeSlice(&lm).SelectAnyOf("type", "written_new") - - regionHierarchy := map[string][]string{} - for _, g := range b.supp.TerritoryContainment.Group { - regions := strings.Split(g.Contains, " ") - regionHierarchy[g.Type] = append(regionHierarchy[g.Type], regions...) - } - regionToGroups := make([]uint8, len(b.region.s)) - - idToIndex := map[string]uint8{} - for i, mv := range lm[0].MatchVariable { - if i > 6 { - log.Fatalf("Too many groups: %d", i) - } - idToIndex[mv.Id] = uint8(i + 1) - // TODO: also handle '-' - for _, r := range strings.Split(mv.Value, "+") { - todo := []string{r} - for k := 0; k < len(todo); k++ { - r := todo[k] - regionToGroups[b.region.index(r)] |= 1 << uint8(i) - todo = append(todo, regionHierarchy[r]...) - } - } - } - b.writeSlice("regionToGroups", regionToGroups) - - // maps language id to in- and out-of-group region. - paradigmLocales := [][3]uint16{} - locales := strings.Split(lm[0].ParadigmLocales[0].Locales, " ") - for i := 0; i < len(locales); i += 2 { - x := [3]uint16{} - for j := 0; j < 2; j++ { - pc := strings.SplitN(locales[i+j], "-", 2) - x[0] = b.langIndex(pc[0]) - if len(pc) == 2 { - x[1+j] = uint16(b.region.index(pc[1])) - } - } - paradigmLocales = append(paradigmLocales, x) - } - b.writeSlice("paradigmLocales", paradigmLocales) - - b.writeType(mutualIntelligibility{}) - b.writeType(scriptIntelligibility{}) - b.writeType(regionIntelligibility{}) - - matchLang := []mutualIntelligibility{} - matchScript := []scriptIntelligibility{} - matchRegion := []regionIntelligibility{} - // Convert the languageMatch entries in lists keyed by desired language. - for _, m := range lm[0].LanguageMatch { - // Different versions of CLDR use different separators. - desired := strings.Replace(m.Desired, "-", "_", -1) - supported := strings.Replace(m.Supported, "-", "_", -1) - d := strings.Split(desired, "_") - s := strings.Split(supported, "_") - if len(d) != len(s) { - log.Fatalf("not supported: desired=%q; supported=%q", desired, supported) - continue - } - distance, _ := strconv.ParseInt(m.Distance, 10, 8) - switch len(d) { - case 2: - if desired == supported && desired == "*_*" { - continue - } - // language-script pair. - matchScript = append(matchScript, scriptIntelligibility{ - wantLang: uint16(b.langIndex(d[0])), - haveLang: uint16(b.langIndex(s[0])), - wantScript: uint8(b.script.index(d[1])), - haveScript: uint8(b.script.index(s[1])), - distance: uint8(distance), - }) - if m.Oneway != "true" { - matchScript = append(matchScript, scriptIntelligibility{ - wantLang: uint16(b.langIndex(s[0])), - haveLang: uint16(b.langIndex(d[0])), - wantScript: uint8(b.script.index(s[1])), - haveScript: uint8(b.script.index(d[1])), - distance: uint8(distance), - }) - } - case 1: - if desired == supported && desired == "*" { - continue - } - if distance == 1 { - // nb == no is already handled by macro mapping. Check there - // really is only this case. - if d[0] != "no" || s[0] != "nb" { - log.Fatalf("unhandled equivalence %s == %s", s[0], d[0]) - } - continue - } - // TODO: consider dropping oneway field and just doubling the entry. - matchLang = append(matchLang, mutualIntelligibility{ - want: uint16(b.langIndex(d[0])), - have: uint16(b.langIndex(s[0])), - distance: uint8(distance), - oneway: m.Oneway == "true", - }) - case 3: - if desired == supported && desired == "*_*_*" { - continue - } - if desired != supported { // (Weird but correct.) - log.Fatalf("not supported: desired=%q; supported=%q", desired, supported) - continue - } - ri := regionIntelligibility{ - lang: b.langIndex(d[0]), - distance: uint8(distance), - } - if d[1] != "*" { - ri.script = uint8(b.script.index(d[1])) - } - switch { - case d[2] == "*": - ri.group = 0x80 // not contained in anything - case strings.HasPrefix(d[2], "$!"): - ri.group = 0x80 - d[2] = "$" + d[2][len("$!"):] - fallthrough - case strings.HasPrefix(d[2], "$"): - ri.group |= idToIndex[d[2]] - } - matchRegion = append(matchRegion, ri) - default: - log.Fatalf("not supported: desired=%q; supported=%q", desired, supported) - } - } - sort.SliceStable(matchLang, func(i, j int) bool { - return matchLang[i].distance < matchLang[j].distance - }) - b.writeSlice("matchLang", matchLang) - - sort.SliceStable(matchScript, func(i, j int) bool { - return matchScript[i].distance < matchScript[j].distance - }) - b.writeSlice("matchScript", matchScript) - - sort.SliceStable(matchRegion, func(i, j int) bool { - return matchRegion[i].distance < matchRegion[j].distance - }) - b.writeSlice("matchRegion", matchRegion) -} - -func (b *builder) writeRegionInclusionData() { - var ( - // mm holds for each group the set of groups with a distance of 1. - mm = make(map[int][]index) - - // containment holds for each group the transitive closure of - // containment of other groups. - containment = make(map[index][]index) - ) - for _, g := range b.supp.TerritoryContainment.Group { - // Skip UN and EURO zone as they are flattening the containment - // relationship. - if g.Type == "EZ" || g.Type == "UN" { - continue - } - group := b.region.index(g.Type) - groupIdx := b.groups[group] - for _, mem := range strings.Split(g.Contains, " ") { - r := b.region.index(mem) - mm[r] = append(mm[r], groupIdx) - if g, ok := b.groups[r]; ok { - mm[group] = append(mm[group], g) - containment[groupIdx] = append(containment[groupIdx], g) - } - } - } - - regionContainment := make([]uint64, len(b.groups)) - for _, g := range b.groups { - l := containment[g] - - // Compute the transitive closure of containment. - for i := 0; i < len(l); i++ { - l = append(l, containment[l[i]]...) - } - - // Compute the bitmask. - regionContainment[g] = 1 << g - for _, v := range l { - regionContainment[g] |= 1 << v - } - } - b.writeSlice("regionContainment", regionContainment) - - regionInclusion := make([]uint8, len(b.region.s)) - bvs := make(map[uint64]index) - // Make the first bitvector positions correspond with the groups. - for r, i := range b.groups { - bv := uint64(1 << i) - for _, g := range mm[r] { - bv |= 1 << g - } - bvs[bv] = i - regionInclusion[r] = uint8(bvs[bv]) - } - for r := 1; r < len(b.region.s); r++ { - if _, ok := b.groups[r]; !ok { - bv := uint64(0) - for _, g := range mm[r] { - bv |= 1 << g - } - if bv == 0 { - // Pick the world for unspecified regions. - bv = 1 << b.groups[b.region.index("001")] - } - if _, ok := bvs[bv]; !ok { - bvs[bv] = index(len(bvs)) - } - regionInclusion[r] = uint8(bvs[bv]) - } - } - b.writeSlice("regionInclusion", regionInclusion) - regionInclusionBits := make([]uint64, len(bvs)) - for k, v := range bvs { - regionInclusionBits[v] = uint64(k) - } - // Add bit vectors for increasingly large distances until a fixed point is reached. - regionInclusionNext := []uint8{} - for i := 0; i < len(regionInclusionBits); i++ { - bits := regionInclusionBits[i] - next := bits - for i := uint(0); i < uint(len(b.groups)); i++ { - if bits&(1<<i) != 0 { - next |= regionInclusionBits[i] - } - } - if _, ok := bvs[next]; !ok { - bvs[next] = index(len(bvs)) - regionInclusionBits = append(regionInclusionBits, next) - } - regionInclusionNext = append(regionInclusionNext, uint8(bvs[next])) - } - b.writeSlice("regionInclusionBits", regionInclusionBits) - b.writeSlice("regionInclusionNext", regionInclusionNext) -} - -type parentRel struct { - lang uint16 - script uint8 - maxScript uint8 - toRegion uint16 - fromRegion []uint16 -} - -func (b *builder) writeParents() { - b.writeType(parentRel{}) - - parents := []parentRel{} - - // Construct parent overrides. - n := 0 - for _, p := range b.data.Supplemental().ParentLocales.ParentLocale { - // Skipping non-standard scripts to root is implemented using addTags. - if p.Parent == "root" { - continue - } - - sub := strings.Split(p.Parent, "_") - parent := parentRel{lang: b.langIndex(sub[0])} - if len(sub) == 2 { - // TODO: check that all undefined scripts are indeed Latn in these - // cases. - parent.maxScript = uint8(b.script.index("Latn")) - parent.toRegion = uint16(b.region.index(sub[1])) - } else { - parent.script = uint8(b.script.index(sub[1])) - parent.maxScript = parent.script - parent.toRegion = uint16(b.region.index(sub[2])) - } - for _, c := range strings.Split(p.Locales, " ") { - region := b.region.index(c[strings.LastIndex(c, "_")+1:]) - parent.fromRegion = append(parent.fromRegion, uint16(region)) - } - parents = append(parents, parent) - n += len(parent.fromRegion) - } - b.writeSliceAddSize("parents", n*2, parents) -} - -func main() { - gen.Init() - - gen.Repackage("gen_common.go", "common.go", "language") - - w := gen.NewCodeWriter() - defer w.WriteGoFile("tables.go", "language") - - fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`) - - b := newBuilder(w) - gen.WriteCLDRVersion(w) - - b.parseIndices() - b.writeType(fromTo{}) - b.writeLanguage() - b.writeScript() - b.writeRegion() - b.writeVariant() - // TODO: b.writeLocale() - b.computeRegionGroups() - b.writeLikelyData() - b.writeMatchData() - b.writeRegionInclusionData() - b.writeParents() -} diff --git a/vendor/golang.org/x/text/language/gen_common.go b/vendor/golang.org/x/text/language/gen_common.go deleted file mode 100644 index 83ce180..0000000 --- a/vendor/golang.org/x/text/language/gen_common.go +++ /dev/null @@ -1,20 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -package main - -// This file contains code common to the maketables.go and the package code. - -// langAliasType is the type of an alias in langAliasMap. -type langAliasType int8 - -const ( - langDeprecated langAliasType = iota - langMacro - langLegacy - - langAliasTypeUnknown langAliasType = -1 -) diff --git a/vendor/golang.org/x/text/language/gen_index.go b/vendor/golang.org/x/text/language/gen_index.go deleted file mode 100644 index eef555c..0000000 --- a/vendor/golang.org/x/text/language/gen_index.go +++ /dev/null @@ -1,162 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -package main - -// This file generates derivative tables based on the language package itself. - -import ( - "bytes" - "flag" - "fmt" - "io/ioutil" - "log" - "reflect" - "sort" - "strings" - - "golang.org/x/text/internal/gen" - "golang.org/x/text/language" - "golang.org/x/text/unicode/cldr" -) - -var ( - test = flag.Bool("test", false, - "test existing tables; can be used to compare web data with package data.") - - draft = flag.String("draft", - "contributed", - `Minimal draft requirements (approved, contributed, provisional, unconfirmed).`) -) - -func main() { - gen.Init() - - // Read the CLDR zip file. - r := gen.OpenCLDRCoreZip() - defer r.Close() - - d := &cldr.Decoder{} - data, err := d.DecodeZip(r) - if err != nil { - log.Fatalf("DecodeZip: %v", err) - } - - w := gen.NewCodeWriter() - defer func() { - buf := &bytes.Buffer{} - - if _, err = w.WriteGo(buf, "language"); err != nil { - log.Fatalf("Error formatting file index.go: %v", err) - } - - // Since we're generating a table for our own package we need to rewrite - // doing the equivalent of go fmt -r 'language.b -> b'. Using - // bytes.Replace will do. - out := bytes.Replace(buf.Bytes(), []byte("language."), nil, -1) - if err := ioutil.WriteFile("index.go", out, 0600); err != nil { - log.Fatalf("Could not create file index.go: %v", err) - } - }() - - m := map[language.Tag]bool{} - for _, lang := range data.Locales() { - // We include all locales unconditionally to be consistent with en_US. - // We want en_US, even though it has no data associated with it. - - // TODO: put any of the languages for which no data exists at the end - // of the index. This allows all components based on ICU to use that - // as the cutoff point. - // if x := data.RawLDML(lang); false || - // x.LocaleDisplayNames != nil || - // x.Characters != nil || - // x.Delimiters != nil || - // x.Measurement != nil || - // x.Dates != nil || - // x.Numbers != nil || - // x.Units != nil || - // x.ListPatterns != nil || - // x.Collations != nil || - // x.Segmentations != nil || - // x.Rbnf != nil || - // x.Annotations != nil || - // x.Metadata != nil { - - // TODO: support POSIX natively, albeit non-standard. - tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1)) - m[tag] = true - // } - } - // Include locales for plural rules, which uses a different structure. - for _, plurals := range data.Supplemental().Plurals { - for _, rules := range plurals.PluralRules { - for _, lang := range strings.Split(rules.Locales, " ") { - m[language.Make(lang)] = true - } - } - } - - var core, special []language.Tag - - for t := range m { - if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" { - log.Fatalf("Unexpected extension %v in %v", x, t) - } - if len(t.Variants()) == 0 && len(t.Extensions()) == 0 { - core = append(core, t) - } else { - special = append(special, t) - } - } - - w.WriteComment(` - NumCompactTags is the number of common tags. The maximum tag is - NumCompactTags-1.`) - w.WriteConst("NumCompactTags", len(core)+len(special)) - - sort.Sort(byAlpha(special)) - w.WriteVar("specialTags", special) - - // TODO: order by frequency? - sort.Sort(byAlpha(core)) - - // Size computations are just an estimate. - w.Size += int(reflect.TypeOf(map[uint32]uint16{}).Size()) - w.Size += len(core) * 6 // size of uint32 and uint16 - - fmt.Fprintln(w) - fmt.Fprintln(w, "var coreTags = map[uint32]uint16{") - fmt.Fprintln(w, "0x0: 0, // und") - i := len(special) + 1 // Und and special tags already written. - for _, t := range core { - if t == language.Und { - continue - } - fmt.Fprint(w.Hash, t, i) - b, s, r := t.Raw() - fmt.Fprintf(w, "0x%s%s%s: %d, // %s\n", - getIndex(b, 3), // 3 is enough as it is guaranteed to be a compact number - getIndex(s, 2), - getIndex(r, 3), - i, t) - i++ - } - fmt.Fprintln(w, "}") -} - -// getIndex prints the subtag type and extracts its index of size nibble. -// If the index is less than n nibbles, the result is prefixed with 0s. -func getIndex(x interface{}, n int) string { - s := fmt.Sprintf("%#v", x) // s is of form Type{typeID: 0x00} - s = s[strings.Index(s, "0x")+2 : len(s)-1] - return strings.Repeat("0", n-len(s)) + s -} - -type byAlpha []language.Tag - -func (a byAlpha) Len() int { return len(a) } -func (a byAlpha) Swap(i, j int) { a[i], a[j] = a[j], a[i] } -func (a byAlpha) Less(i, j int) bool { return a[i].String() < a[j].String() } diff --git a/vendor/golang.org/x/text/language/go1_1.go b/vendor/golang.org/x/text/language/go1_1.go deleted file mode 100644 index 380f4c0..0000000 --- a/vendor/golang.org/x/text/language/go1_1.go +++ /dev/null @@ -1,38 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build !go1.2 - -package language - -import "sort" - -func sortStable(s sort.Interface) { - ss := stableSort{ - s: s, - pos: make([]int, s.Len()), - } - for i := range ss.pos { - ss.pos[i] = i - } - sort.Sort(&ss) -} - -type stableSort struct { - s sort.Interface - pos []int -} - -func (s *stableSort) Len() int { - return len(s.pos) -} - -func (s *stableSort) Less(i, j int) bool { - return s.s.Less(i, j) || !s.s.Less(j, i) && s.pos[i] < s.pos[j] -} - -func (s *stableSort) Swap(i, j int) { - s.s.Swap(i, j) - s.pos[i], s.pos[j] = s.pos[j], s.pos[i] -} diff --git a/vendor/golang.org/x/text/language/go1_2.go b/vendor/golang.org/x/text/language/go1_2.go deleted file mode 100644 index 38268c5..0000000 --- a/vendor/golang.org/x/text/language/go1_2.go +++ /dev/null @@ -1,11 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build go1.2 - -package language - -import "sort" - -var sortStable = sort.Stable diff --git a/vendor/golang.org/x/text/language/index.go b/vendor/golang.org/x/text/language/index.go deleted file mode 100644 index 69ac557..0000000 --- a/vendor/golang.org/x/text/language/index.go +++ /dev/null @@ -1,769 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -// NumCompactTags is the number of common tags. The maximum tag is -// NumCompactTags-1. -const NumCompactTags = 754 - -var specialTags = []Tag{ // 2 elements - 0: {lang: 0xd7, region: 0x6e, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"}, - 1: {lang: 0x138, region: 0x135, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"}, -} // Size: 72 bytes - -var coreTags = map[uint32]uint16{ - 0x0: 0, // und - 0x01600000: 3, // af - 0x016000d2: 4, // af-NA - 0x01600161: 5, // af-ZA - 0x01c00000: 6, // agq - 0x01c00052: 7, // agq-CM - 0x02100000: 8, // ak - 0x02100080: 9, // ak-GH - 0x02700000: 10, // am - 0x0270006f: 11, // am-ET - 0x03a00000: 12, // ar - 0x03a00001: 13, // ar-001 - 0x03a00023: 14, // ar-AE - 0x03a00039: 15, // ar-BH - 0x03a00062: 16, // ar-DJ - 0x03a00067: 17, // ar-DZ - 0x03a0006b: 18, // ar-EG - 0x03a0006c: 19, // ar-EH - 0x03a0006d: 20, // ar-ER - 0x03a00097: 21, // ar-IL - 0x03a0009b: 22, // ar-IQ - 0x03a000a1: 23, // ar-JO - 0x03a000a8: 24, // ar-KM - 0x03a000ac: 25, // ar-KW - 0x03a000b0: 26, // ar-LB - 0x03a000b9: 27, // ar-LY - 0x03a000ba: 28, // ar-MA - 0x03a000c9: 29, // ar-MR - 0x03a000e1: 30, // ar-OM - 0x03a000ed: 31, // ar-PS - 0x03a000f3: 32, // ar-QA - 0x03a00108: 33, // ar-SA - 0x03a0010b: 34, // ar-SD - 0x03a00115: 35, // ar-SO - 0x03a00117: 36, // ar-SS - 0x03a0011c: 37, // ar-SY - 0x03a00120: 38, // ar-TD - 0x03a00128: 39, // ar-TN - 0x03a0015e: 40, // ar-YE - 0x04000000: 41, // ars - 0x04300000: 42, // as - 0x04300099: 43, // as-IN - 0x04400000: 44, // asa - 0x0440012f: 45, // asa-TZ - 0x04800000: 46, // ast - 0x0480006e: 47, // ast-ES - 0x05800000: 48, // az - 0x0581e000: 49, // az-Cyrl - 0x0581e032: 50, // az-Cyrl-AZ - 0x05855000: 51, // az-Latn - 0x05855032: 52, // az-Latn-AZ - 0x05e00000: 53, // bas - 0x05e00052: 54, // bas-CM - 0x07100000: 55, // be - 0x07100047: 56, // be-BY - 0x07500000: 57, // bem - 0x07500162: 58, // bem-ZM - 0x07900000: 59, // bez - 0x0790012f: 60, // bez-TZ - 0x07e00000: 61, // bg - 0x07e00038: 62, // bg-BG - 0x08200000: 63, // bh - 0x0a000000: 64, // bm - 0x0a0000c3: 65, // bm-ML - 0x0a500000: 66, // bn - 0x0a500035: 67, // bn-BD - 0x0a500099: 68, // bn-IN - 0x0a900000: 69, // bo - 0x0a900053: 70, // bo-CN - 0x0a900099: 71, // bo-IN - 0x0b200000: 72, // br - 0x0b200078: 73, // br-FR - 0x0b500000: 74, // brx - 0x0b500099: 75, // brx-IN - 0x0b700000: 76, // bs - 0x0b71e000: 77, // bs-Cyrl - 0x0b71e033: 78, // bs-Cyrl-BA - 0x0b755000: 79, // bs-Latn - 0x0b755033: 80, // bs-Latn-BA - 0x0d700000: 81, // ca - 0x0d700022: 82, // ca-AD - 0x0d70006e: 83, // ca-ES - 0x0d700078: 84, // ca-FR - 0x0d70009e: 85, // ca-IT - 0x0dc00000: 86, // ce - 0x0dc00106: 87, // ce-RU - 0x0df00000: 88, // cgg - 0x0df00131: 89, // cgg-UG - 0x0e500000: 90, // chr - 0x0e500135: 91, // chr-US - 0x0e900000: 92, // ckb - 0x0e90009b: 93, // ckb-IQ - 0x0e90009c: 94, // ckb-IR - 0x0f900000: 95, // cs - 0x0f90005e: 96, // cs-CZ - 0x0fd00000: 97, // cu - 0x0fd00106: 98, // cu-RU - 0x0ff00000: 99, // cy - 0x0ff0007b: 100, // cy-GB - 0x10000000: 101, // da - 0x10000063: 102, // da-DK - 0x10000082: 103, // da-GL - 0x10700000: 104, // dav - 0x107000a4: 105, // dav-KE - 0x10c00000: 106, // de - 0x10c0002e: 107, // de-AT - 0x10c00036: 108, // de-BE - 0x10c0004e: 109, // de-CH - 0x10c00060: 110, // de-DE - 0x10c0009e: 111, // de-IT - 0x10c000b2: 112, // de-LI - 0x10c000b7: 113, // de-LU - 0x11600000: 114, // dje - 0x116000d4: 115, // dje-NE - 0x11e00000: 116, // dsb - 0x11e00060: 117, // dsb-DE - 0x12300000: 118, // dua - 0x12300052: 119, // dua-CM - 0x12700000: 120, // dv - 0x12a00000: 121, // dyo - 0x12a00114: 122, // dyo-SN - 0x12c00000: 123, // dz - 0x12c00043: 124, // dz-BT - 0x12e00000: 125, // ebu - 0x12e000a4: 126, // ebu-KE - 0x12f00000: 127, // ee - 0x12f00080: 128, // ee-GH - 0x12f00122: 129, // ee-TG - 0x13500000: 130, // el - 0x1350005d: 131, // el-CY - 0x13500087: 132, // el-GR - 0x13800000: 133, // en - 0x13800001: 134, // en-001 - 0x1380001a: 135, // en-150 - 0x13800025: 136, // en-AG - 0x13800026: 137, // en-AI - 0x1380002d: 138, // en-AS - 0x1380002e: 139, // en-AT - 0x1380002f: 140, // en-AU - 0x13800034: 141, // en-BB - 0x13800036: 142, // en-BE - 0x1380003a: 143, // en-BI - 0x1380003d: 144, // en-BM - 0x13800042: 145, // en-BS - 0x13800046: 146, // en-BW - 0x13800048: 147, // en-BZ - 0x13800049: 148, // en-CA - 0x1380004a: 149, // en-CC - 0x1380004e: 150, // en-CH - 0x13800050: 151, // en-CK - 0x13800052: 152, // en-CM - 0x1380005c: 153, // en-CX - 0x1380005d: 154, // en-CY - 0x13800060: 155, // en-DE - 0x13800061: 156, // en-DG - 0x13800063: 157, // en-DK - 0x13800064: 158, // en-DM - 0x1380006d: 159, // en-ER - 0x13800072: 160, // en-FI - 0x13800073: 161, // en-FJ - 0x13800074: 162, // en-FK - 0x13800075: 163, // en-FM - 0x1380007b: 164, // en-GB - 0x1380007c: 165, // en-GD - 0x1380007f: 166, // en-GG - 0x13800080: 167, // en-GH - 0x13800081: 168, // en-GI - 0x13800083: 169, // en-GM - 0x1380008a: 170, // en-GU - 0x1380008c: 171, // en-GY - 0x1380008d: 172, // en-HK - 0x13800096: 173, // en-IE - 0x13800097: 174, // en-IL - 0x13800098: 175, // en-IM - 0x13800099: 176, // en-IN - 0x1380009a: 177, // en-IO - 0x1380009f: 178, // en-JE - 0x138000a0: 179, // en-JM - 0x138000a4: 180, // en-KE - 0x138000a7: 181, // en-KI - 0x138000a9: 182, // en-KN - 0x138000ad: 183, // en-KY - 0x138000b1: 184, // en-LC - 0x138000b4: 185, // en-LR - 0x138000b5: 186, // en-LS - 0x138000bf: 187, // en-MG - 0x138000c0: 188, // en-MH - 0x138000c6: 189, // en-MO - 0x138000c7: 190, // en-MP - 0x138000ca: 191, // en-MS - 0x138000cb: 192, // en-MT - 0x138000cc: 193, // en-MU - 0x138000ce: 194, // en-MW - 0x138000d0: 195, // en-MY - 0x138000d2: 196, // en-NA - 0x138000d5: 197, // en-NF - 0x138000d6: 198, // en-NG - 0x138000d9: 199, // en-NL - 0x138000dd: 200, // en-NR - 0x138000df: 201, // en-NU - 0x138000e0: 202, // en-NZ - 0x138000e6: 203, // en-PG - 0x138000e7: 204, // en-PH - 0x138000e8: 205, // en-PK - 0x138000eb: 206, // en-PN - 0x138000ec: 207, // en-PR - 0x138000f0: 208, // en-PW - 0x13800107: 209, // en-RW - 0x13800109: 210, // en-SB - 0x1380010a: 211, // en-SC - 0x1380010b: 212, // en-SD - 0x1380010c: 213, // en-SE - 0x1380010d: 214, // en-SG - 0x1380010e: 215, // en-SH - 0x1380010f: 216, // en-SI - 0x13800112: 217, // en-SL - 0x13800117: 218, // en-SS - 0x1380011b: 219, // en-SX - 0x1380011d: 220, // en-SZ - 0x1380011f: 221, // en-TC - 0x13800125: 222, // en-TK - 0x13800129: 223, // en-TO - 0x1380012c: 224, // en-TT - 0x1380012d: 225, // en-TV - 0x1380012f: 226, // en-TZ - 0x13800131: 227, // en-UG - 0x13800133: 228, // en-UM - 0x13800135: 229, // en-US - 0x13800139: 230, // en-VC - 0x1380013c: 231, // en-VG - 0x1380013d: 232, // en-VI - 0x1380013f: 233, // en-VU - 0x13800142: 234, // en-WS - 0x13800161: 235, // en-ZA - 0x13800162: 236, // en-ZM - 0x13800164: 237, // en-ZW - 0x13b00000: 238, // eo - 0x13b00001: 239, // eo-001 - 0x13d00000: 240, // es - 0x13d0001f: 241, // es-419 - 0x13d0002c: 242, // es-AR - 0x13d0003f: 243, // es-BO - 0x13d00041: 244, // es-BR - 0x13d00048: 245, // es-BZ - 0x13d00051: 246, // es-CL - 0x13d00054: 247, // es-CO - 0x13d00056: 248, // es-CR - 0x13d00059: 249, // es-CU - 0x13d00065: 250, // es-DO - 0x13d00068: 251, // es-EA - 0x13d00069: 252, // es-EC - 0x13d0006e: 253, // es-ES - 0x13d00086: 254, // es-GQ - 0x13d00089: 255, // es-GT - 0x13d0008f: 256, // es-HN - 0x13d00094: 257, // es-IC - 0x13d000cf: 258, // es-MX - 0x13d000d8: 259, // es-NI - 0x13d000e2: 260, // es-PA - 0x13d000e4: 261, // es-PE - 0x13d000e7: 262, // es-PH - 0x13d000ec: 263, // es-PR - 0x13d000f1: 264, // es-PY - 0x13d0011a: 265, // es-SV - 0x13d00135: 266, // es-US - 0x13d00136: 267, // es-UY - 0x13d0013b: 268, // es-VE - 0x13f00000: 269, // et - 0x13f0006a: 270, // et-EE - 0x14400000: 271, // eu - 0x1440006e: 272, // eu-ES - 0x14500000: 273, // ewo - 0x14500052: 274, // ewo-CM - 0x14700000: 275, // fa - 0x14700024: 276, // fa-AF - 0x1470009c: 277, // fa-IR - 0x14d00000: 278, // ff - 0x14d00052: 279, // ff-CM - 0x14d00084: 280, // ff-GN - 0x14d000c9: 281, // ff-MR - 0x14d00114: 282, // ff-SN - 0x15000000: 283, // fi - 0x15000072: 284, // fi-FI - 0x15200000: 285, // fil - 0x152000e7: 286, // fil-PH - 0x15700000: 287, // fo - 0x15700063: 288, // fo-DK - 0x15700076: 289, // fo-FO - 0x15d00000: 290, // fr - 0x15d00036: 291, // fr-BE - 0x15d00037: 292, // fr-BF - 0x15d0003a: 293, // fr-BI - 0x15d0003b: 294, // fr-BJ - 0x15d0003c: 295, // fr-BL - 0x15d00049: 296, // fr-CA - 0x15d0004b: 297, // fr-CD - 0x15d0004c: 298, // fr-CF - 0x15d0004d: 299, // fr-CG - 0x15d0004e: 300, // fr-CH - 0x15d0004f: 301, // fr-CI - 0x15d00052: 302, // fr-CM - 0x15d00062: 303, // fr-DJ - 0x15d00067: 304, // fr-DZ - 0x15d00078: 305, // fr-FR - 0x15d0007a: 306, // fr-GA - 0x15d0007e: 307, // fr-GF - 0x15d00084: 308, // fr-GN - 0x15d00085: 309, // fr-GP - 0x15d00086: 310, // fr-GQ - 0x15d00091: 311, // fr-HT - 0x15d000a8: 312, // fr-KM - 0x15d000b7: 313, // fr-LU - 0x15d000ba: 314, // fr-MA - 0x15d000bb: 315, // fr-MC - 0x15d000be: 316, // fr-MF - 0x15d000bf: 317, // fr-MG - 0x15d000c3: 318, // fr-ML - 0x15d000c8: 319, // fr-MQ - 0x15d000c9: 320, // fr-MR - 0x15d000cc: 321, // fr-MU - 0x15d000d3: 322, // fr-NC - 0x15d000d4: 323, // fr-NE - 0x15d000e5: 324, // fr-PF - 0x15d000ea: 325, // fr-PM - 0x15d00102: 326, // fr-RE - 0x15d00107: 327, // fr-RW - 0x15d0010a: 328, // fr-SC - 0x15d00114: 329, // fr-SN - 0x15d0011c: 330, // fr-SY - 0x15d00120: 331, // fr-TD - 0x15d00122: 332, // fr-TG - 0x15d00128: 333, // fr-TN - 0x15d0013f: 334, // fr-VU - 0x15d00140: 335, // fr-WF - 0x15d0015f: 336, // fr-YT - 0x16800000: 337, // fur - 0x1680009e: 338, // fur-IT - 0x16c00000: 339, // fy - 0x16c000d9: 340, // fy-NL - 0x16d00000: 341, // ga - 0x16d00096: 342, // ga-IE - 0x17c00000: 343, // gd - 0x17c0007b: 344, // gd-GB - 0x18e00000: 345, // gl - 0x18e0006e: 346, // gl-ES - 0x1a100000: 347, // gsw - 0x1a10004e: 348, // gsw-CH - 0x1a100078: 349, // gsw-FR - 0x1a1000b2: 350, // gsw-LI - 0x1a200000: 351, // gu - 0x1a200099: 352, // gu-IN - 0x1a700000: 353, // guw - 0x1a900000: 354, // guz - 0x1a9000a4: 355, // guz-KE - 0x1aa00000: 356, // gv - 0x1aa00098: 357, // gv-IM - 0x1b200000: 358, // ha - 0x1b200080: 359, // ha-GH - 0x1b2000d4: 360, // ha-NE - 0x1b2000d6: 361, // ha-NG - 0x1b600000: 362, // haw - 0x1b600135: 363, // haw-US - 0x1ba00000: 364, // he - 0x1ba00097: 365, // he-IL - 0x1bc00000: 366, // hi - 0x1bc00099: 367, // hi-IN - 0x1cf00000: 368, // hr - 0x1cf00033: 369, // hr-BA - 0x1cf00090: 370, // hr-HR - 0x1d000000: 371, // hsb - 0x1d000060: 372, // hsb-DE - 0x1d300000: 373, // hu - 0x1d300092: 374, // hu-HU - 0x1d500000: 375, // hy - 0x1d500028: 376, // hy-AM - 0x1df00000: 377, // id - 0x1df00095: 378, // id-ID - 0x1e500000: 379, // ig - 0x1e5000d6: 380, // ig-NG - 0x1e800000: 381, // ii - 0x1e800053: 382, // ii-CN - 0x1f600000: 383, // is - 0x1f60009d: 384, // is-IS - 0x1f700000: 385, // it - 0x1f70004e: 386, // it-CH - 0x1f70009e: 387, // it-IT - 0x1f700113: 388, // it-SM - 0x1f700138: 389, // it-VA - 0x1f800000: 390, // iu - 0x1fe00000: 391, // ja - 0x1fe000a2: 392, // ja-JP - 0x20100000: 393, // jbo - 0x20500000: 394, // jgo - 0x20500052: 395, // jgo-CM - 0x20800000: 396, // jmc - 0x2080012f: 397, // jmc-TZ - 0x20c00000: 398, // jv - 0x20e00000: 399, // ka - 0x20e0007d: 400, // ka-GE - 0x21000000: 401, // kab - 0x21000067: 402, // kab-DZ - 0x21400000: 403, // kaj - 0x21500000: 404, // kam - 0x215000a4: 405, // kam-KE - 0x21d00000: 406, // kcg - 0x22100000: 407, // kde - 0x2210012f: 408, // kde-TZ - 0x22500000: 409, // kea - 0x2250005a: 410, // kea-CV - 0x23200000: 411, // khq - 0x232000c3: 412, // khq-ML - 0x23700000: 413, // ki - 0x237000a4: 414, // ki-KE - 0x24000000: 415, // kk - 0x240000ae: 416, // kk-KZ - 0x24200000: 417, // kkj - 0x24200052: 418, // kkj-CM - 0x24300000: 419, // kl - 0x24300082: 420, // kl-GL - 0x24400000: 421, // kln - 0x244000a4: 422, // kln-KE - 0x24800000: 423, // km - 0x248000a6: 424, // km-KH - 0x24f00000: 425, // kn - 0x24f00099: 426, // kn-IN - 0x25200000: 427, // ko - 0x252000aa: 428, // ko-KP - 0x252000ab: 429, // ko-KR - 0x25400000: 430, // kok - 0x25400099: 431, // kok-IN - 0x26800000: 432, // ks - 0x26800099: 433, // ks-IN - 0x26900000: 434, // ksb - 0x2690012f: 435, // ksb-TZ - 0x26b00000: 436, // ksf - 0x26b00052: 437, // ksf-CM - 0x26c00000: 438, // ksh - 0x26c00060: 439, // ksh-DE - 0x27200000: 440, // ku - 0x27f00000: 441, // kw - 0x27f0007b: 442, // kw-GB - 0x28800000: 443, // ky - 0x288000a5: 444, // ky-KG - 0x28f00000: 445, // lag - 0x28f0012f: 446, // lag-TZ - 0x29300000: 447, // lb - 0x293000b7: 448, // lb-LU - 0x2a100000: 449, // lg - 0x2a100131: 450, // lg-UG - 0x2ad00000: 451, // lkt - 0x2ad00135: 452, // lkt-US - 0x2b300000: 453, // ln - 0x2b30002a: 454, // ln-AO - 0x2b30004b: 455, // ln-CD - 0x2b30004c: 456, // ln-CF - 0x2b30004d: 457, // ln-CG - 0x2b600000: 458, // lo - 0x2b6000af: 459, // lo-LA - 0x2bd00000: 460, // lrc - 0x2bd0009b: 461, // lrc-IQ - 0x2bd0009c: 462, // lrc-IR - 0x2be00000: 463, // lt - 0x2be000b6: 464, // lt-LT - 0x2c000000: 465, // lu - 0x2c00004b: 466, // lu-CD - 0x2c200000: 467, // luo - 0x2c2000a4: 468, // luo-KE - 0x2c300000: 469, // luy - 0x2c3000a4: 470, // luy-KE - 0x2c500000: 471, // lv - 0x2c5000b8: 472, // lv-LV - 0x2cf00000: 473, // mas - 0x2cf000a4: 474, // mas-KE - 0x2cf0012f: 475, // mas-TZ - 0x2e700000: 476, // mer - 0x2e7000a4: 477, // mer-KE - 0x2eb00000: 478, // mfe - 0x2eb000cc: 479, // mfe-MU - 0x2ef00000: 480, // mg - 0x2ef000bf: 481, // mg-MG - 0x2f000000: 482, // mgh - 0x2f0000d1: 483, // mgh-MZ - 0x2f200000: 484, // mgo - 0x2f200052: 485, // mgo-CM - 0x2fd00000: 486, // mk - 0x2fd000c2: 487, // mk-MK - 0x30200000: 488, // ml - 0x30200099: 489, // ml-IN - 0x30900000: 490, // mn - 0x309000c5: 491, // mn-MN - 0x31900000: 492, // mr - 0x31900099: 493, // mr-IN - 0x31d00000: 494, // ms - 0x31d0003e: 495, // ms-BN - 0x31d000d0: 496, // ms-MY - 0x31d0010d: 497, // ms-SG - 0x31e00000: 498, // mt - 0x31e000cb: 499, // mt-MT - 0x32300000: 500, // mua - 0x32300052: 501, // mua-CM - 0x32f00000: 502, // my - 0x32f000c4: 503, // my-MM - 0x33800000: 504, // mzn - 0x3380009c: 505, // mzn-IR - 0x33f00000: 506, // nah - 0x34300000: 507, // naq - 0x343000d2: 508, // naq-NA - 0x34500000: 509, // nb - 0x345000da: 510, // nb-NO - 0x34500110: 511, // nb-SJ - 0x34c00000: 512, // nd - 0x34c00164: 513, // nd-ZW - 0x34e00000: 514, // nds - 0x34e00060: 515, // nds-DE - 0x34e000d9: 516, // nds-NL - 0x34f00000: 517, // ne - 0x34f00099: 518, // ne-IN - 0x34f000db: 519, // ne-NP - 0x36500000: 520, // nl - 0x36500030: 521, // nl-AW - 0x36500036: 522, // nl-BE - 0x36500040: 523, // nl-BQ - 0x3650005b: 524, // nl-CW - 0x365000d9: 525, // nl-NL - 0x36500116: 526, // nl-SR - 0x3650011b: 527, // nl-SX - 0x36600000: 528, // nmg - 0x36600052: 529, // nmg-CM - 0x36800000: 530, // nn - 0x368000da: 531, // nn-NO - 0x36a00000: 532, // nnh - 0x36a00052: 533, // nnh-CM - 0x36d00000: 534, // no - 0x37300000: 535, // nqo - 0x37400000: 536, // nr - 0x37800000: 537, // nso - 0x37e00000: 538, // nus - 0x37e00117: 539, // nus-SS - 0x38500000: 540, // ny - 0x38700000: 541, // nyn - 0x38700131: 542, // nyn-UG - 0x38e00000: 543, // om - 0x38e0006f: 544, // om-ET - 0x38e000a4: 545, // om-KE - 0x39300000: 546, // or - 0x39300099: 547, // or-IN - 0x39600000: 548, // os - 0x3960007d: 549, // os-GE - 0x39600106: 550, // os-RU - 0x39b00000: 551, // pa - 0x39b05000: 552, // pa-Arab - 0x39b050e8: 553, // pa-Arab-PK - 0x39b32000: 554, // pa-Guru - 0x39b32099: 555, // pa-Guru-IN - 0x39f00000: 556, // pap - 0x3b100000: 557, // pl - 0x3b1000e9: 558, // pl-PL - 0x3bb00000: 559, // prg - 0x3bb00001: 560, // prg-001 - 0x3bc00000: 561, // ps - 0x3bc00024: 562, // ps-AF - 0x3be00000: 563, // pt - 0x3be0002a: 564, // pt-AO - 0x3be00041: 565, // pt-BR - 0x3be0004e: 566, // pt-CH - 0x3be0005a: 567, // pt-CV - 0x3be00086: 568, // pt-GQ - 0x3be0008b: 569, // pt-GW - 0x3be000b7: 570, // pt-LU - 0x3be000c6: 571, // pt-MO - 0x3be000d1: 572, // pt-MZ - 0x3be000ee: 573, // pt-PT - 0x3be00118: 574, // pt-ST - 0x3be00126: 575, // pt-TL - 0x3c200000: 576, // qu - 0x3c20003f: 577, // qu-BO - 0x3c200069: 578, // qu-EC - 0x3c2000e4: 579, // qu-PE - 0x3d200000: 580, // rm - 0x3d20004e: 581, // rm-CH - 0x3d700000: 582, // rn - 0x3d70003a: 583, // rn-BI - 0x3da00000: 584, // ro - 0x3da000bc: 585, // ro-MD - 0x3da00104: 586, // ro-RO - 0x3dc00000: 587, // rof - 0x3dc0012f: 588, // rof-TZ - 0x3e000000: 589, // ru - 0x3e000047: 590, // ru-BY - 0x3e0000a5: 591, // ru-KG - 0x3e0000ae: 592, // ru-KZ - 0x3e0000bc: 593, // ru-MD - 0x3e000106: 594, // ru-RU - 0x3e000130: 595, // ru-UA - 0x3e300000: 596, // rw - 0x3e300107: 597, // rw-RW - 0x3e400000: 598, // rwk - 0x3e40012f: 599, // rwk-TZ - 0x3e900000: 600, // sah - 0x3e900106: 601, // sah-RU - 0x3ea00000: 602, // saq - 0x3ea000a4: 603, // saq-KE - 0x3f100000: 604, // sbp - 0x3f10012f: 605, // sbp-TZ - 0x3fa00000: 606, // sdh - 0x3fb00000: 607, // se - 0x3fb00072: 608, // se-FI - 0x3fb000da: 609, // se-NO - 0x3fb0010c: 610, // se-SE - 0x3fd00000: 611, // seh - 0x3fd000d1: 612, // seh-MZ - 0x3ff00000: 613, // ses - 0x3ff000c3: 614, // ses-ML - 0x40000000: 615, // sg - 0x4000004c: 616, // sg-CF - 0x40600000: 617, // shi - 0x40655000: 618, // shi-Latn - 0x406550ba: 619, // shi-Latn-MA - 0x406d8000: 620, // shi-Tfng - 0x406d80ba: 621, // shi-Tfng-MA - 0x40a00000: 622, // si - 0x40a000b3: 623, // si-LK - 0x41000000: 624, // sk - 0x41000111: 625, // sk-SK - 0x41400000: 626, // sl - 0x4140010f: 627, // sl-SI - 0x41a00000: 628, // sma - 0x41b00000: 629, // smi - 0x41c00000: 630, // smj - 0x41d00000: 631, // smn - 0x41d00072: 632, // smn-FI - 0x42000000: 633, // sms - 0x42100000: 634, // sn - 0x42100164: 635, // sn-ZW - 0x42700000: 636, // so - 0x42700062: 637, // so-DJ - 0x4270006f: 638, // so-ET - 0x427000a4: 639, // so-KE - 0x42700115: 640, // so-SO - 0x42f00000: 641, // sq - 0x42f00027: 642, // sq-AL - 0x42f000c2: 643, // sq-MK - 0x42f0014d: 644, // sq-XK - 0x43000000: 645, // sr - 0x4301e000: 646, // sr-Cyrl - 0x4301e033: 647, // sr-Cyrl-BA - 0x4301e0bd: 648, // sr-Cyrl-ME - 0x4301e105: 649, // sr-Cyrl-RS - 0x4301e14d: 650, // sr-Cyrl-XK - 0x43055000: 651, // sr-Latn - 0x43055033: 652, // sr-Latn-BA - 0x430550bd: 653, // sr-Latn-ME - 0x43055105: 654, // sr-Latn-RS - 0x4305514d: 655, // sr-Latn-XK - 0x43500000: 656, // ss - 0x43800000: 657, // ssy - 0x43900000: 658, // st - 0x44200000: 659, // sv - 0x44200031: 660, // sv-AX - 0x44200072: 661, // sv-FI - 0x4420010c: 662, // sv-SE - 0x44300000: 663, // sw - 0x4430004b: 664, // sw-CD - 0x443000a4: 665, // sw-KE - 0x4430012f: 666, // sw-TZ - 0x44300131: 667, // sw-UG - 0x44c00000: 668, // syr - 0x44e00000: 669, // ta - 0x44e00099: 670, // ta-IN - 0x44e000b3: 671, // ta-LK - 0x44e000d0: 672, // ta-MY - 0x44e0010d: 673, // ta-SG - 0x45f00000: 674, // te - 0x45f00099: 675, // te-IN - 0x46200000: 676, // teo - 0x462000a4: 677, // teo-KE - 0x46200131: 678, // teo-UG - 0x46900000: 679, // th - 0x46900123: 680, // th-TH - 0x46d00000: 681, // ti - 0x46d0006d: 682, // ti-ER - 0x46d0006f: 683, // ti-ET - 0x46f00000: 684, // tig - 0x47400000: 685, // tk - 0x47400127: 686, // tk-TM - 0x47e00000: 687, // tn - 0x48000000: 688, // to - 0x48000129: 689, // to-TO - 0x48800000: 690, // tr - 0x4880005d: 691, // tr-CY - 0x4880012b: 692, // tr-TR - 0x48c00000: 693, // ts - 0x4a200000: 694, // twq - 0x4a2000d4: 695, // twq-NE - 0x4a700000: 696, // tzm - 0x4a7000ba: 697, // tzm-MA - 0x4aa00000: 698, // ug - 0x4aa00053: 699, // ug-CN - 0x4ac00000: 700, // uk - 0x4ac00130: 701, // uk-UA - 0x4b200000: 702, // ur - 0x4b200099: 703, // ur-IN - 0x4b2000e8: 704, // ur-PK - 0x4ba00000: 705, // uz - 0x4ba05000: 706, // uz-Arab - 0x4ba05024: 707, // uz-Arab-AF - 0x4ba1e000: 708, // uz-Cyrl - 0x4ba1e137: 709, // uz-Cyrl-UZ - 0x4ba55000: 710, // uz-Latn - 0x4ba55137: 711, // uz-Latn-UZ - 0x4bc00000: 712, // vai - 0x4bc55000: 713, // vai-Latn - 0x4bc550b4: 714, // vai-Latn-LR - 0x4bcdf000: 715, // vai-Vaii - 0x4bcdf0b4: 716, // vai-Vaii-LR - 0x4be00000: 717, // ve - 0x4c100000: 718, // vi - 0x4c10013e: 719, // vi-VN - 0x4c700000: 720, // vo - 0x4c700001: 721, // vo-001 - 0x4ca00000: 722, // vun - 0x4ca0012f: 723, // vun-TZ - 0x4cc00000: 724, // wa - 0x4cd00000: 725, // wae - 0x4cd0004e: 726, // wae-CH - 0x4e300000: 727, // wo - 0x4f000000: 728, // xh - 0x4f900000: 729, // xog - 0x4f900131: 730, // xog-UG - 0x50700000: 731, // yav - 0x50700052: 732, // yav-CM - 0x51000000: 733, // yi - 0x51000001: 734, // yi-001 - 0x51600000: 735, // yo - 0x5160003b: 736, // yo-BJ - 0x516000d6: 737, // yo-NG - 0x51d00000: 738, // yue - 0x51d0008d: 739, // yue-HK - 0x52600000: 740, // zgh - 0x526000ba: 741, // zgh-MA - 0x52700000: 742, // zh - 0x52737000: 743, // zh-Hans - 0x52737053: 744, // zh-Hans-CN - 0x5273708d: 745, // zh-Hans-HK - 0x527370c6: 746, // zh-Hans-MO - 0x5273710d: 747, // zh-Hans-SG - 0x52738000: 748, // zh-Hant - 0x5273808d: 749, // zh-Hant-HK - 0x527380c6: 750, // zh-Hant-MO - 0x5273812e: 751, // zh-Hant-TW - 0x52c00000: 752, // zu - 0x52c00161: 753, // zu-ZA -} - -// Total table size 4592 bytes (4KiB); checksum: C25F8AFF diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go deleted file mode 100644 index ed1011f..0000000 --- a/vendor/golang.org/x/text/language/language.go +++ /dev/null @@ -1,887 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go gen_common.go -output tables.go -//go:generate go run gen_index.go - -package language - -// TODO: Remove above NOTE after: -// - verifying that tables are dropped correctly (most notably matcher tables). - -import ( - "errors" - "fmt" - "strings" -) - -const ( - // maxCoreSize is the maximum size of a BCP 47 tag without variants and - // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. - maxCoreSize = 12 - - // max99thPercentileSize is a somewhat arbitrary buffer size that presumably - // is large enough to hold at least 99% of the BCP 47 tags. - max99thPercentileSize = 32 - - // maxSimpleUExtensionSize is the maximum size of a -u extension with one - // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). - maxSimpleUExtensionSize = 14 -) - -// Tag represents a BCP 47 language tag. It is used to specify an instance of a -// specific language or locale. All language tag values are guaranteed to be -// well-formed. -type Tag struct { - lang langID - region regionID - // TODO: we will soon run out of positions for script. Idea: instead of - // storing lang, region, and script codes, store only the compact index and - // have a lookup table from this code to its expansion. This greatly speeds - // up table lookup, speed up common variant cases. - // This will also immediately free up 3 extra bytes. Also, the pVariant - // field can now be moved to the lookup table, as the compact index uniquely - // determines the offset of a possible variant. - script scriptID - pVariant byte // offset in str, includes preceding '-' - pExt uint16 // offset of first extension, includes preceding '-' - - // str is the string representation of the Tag. It will only be used if the - // tag has variants or extensions. - str string -} - -// Make is a convenience wrapper for Parse that omits the error. -// In case of an error, a sensible default is returned. -func Make(s string) Tag { - return Default.Make(s) -} - -// Make is a convenience wrapper for c.Parse that omits the error. -// In case of an error, a sensible default is returned. -func (c CanonType) Make(s string) Tag { - t, _ := c.Parse(s) - return t -} - -// Raw returns the raw base language, script and region, without making an -// attempt to infer their values. -func (t Tag) Raw() (b Base, s Script, r Region) { - return Base{t.lang}, Script{t.script}, Region{t.region} -} - -// equalTags compares language, script and region subtags only. -func (t Tag) equalTags(a Tag) bool { - return t.lang == a.lang && t.script == a.script && t.region == a.region -} - -// IsRoot returns true if t is equal to language "und". -func (t Tag) IsRoot() bool { - if int(t.pVariant) < len(t.str) { - return false - } - return t.equalTags(und) -} - -// private reports whether the Tag consists solely of a private use tag. -func (t Tag) private() bool { - return t.str != "" && t.pVariant == 0 -} - -// CanonType can be used to enable or disable various types of canonicalization. -type CanonType int - -const ( - // Replace deprecated base languages with their preferred replacements. - DeprecatedBase CanonType = 1 << iota - // Replace deprecated scripts with their preferred replacements. - DeprecatedScript - // Replace deprecated regions with their preferred replacements. - DeprecatedRegion - // Remove redundant scripts. - SuppressScript - // Normalize legacy encodings. This includes legacy languages defined in - // CLDR as well as bibliographic codes defined in ISO-639. - Legacy - // Map the dominant language of a macro language group to the macro language - // subtag. For example cmn -> zh. - Macro - // The CLDR flag should be used if full compatibility with CLDR is required. - // There are a few cases where language.Tag may differ from CLDR. To follow all - // of CLDR's suggestions, use All|CLDR. - CLDR - - // Raw can be used to Compose or Parse without Canonicalization. - Raw CanonType = 0 - - // Replace all deprecated tags with their preferred replacements. - Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion - - // All canonicalizations recommended by BCP 47. - BCP47 = Deprecated | SuppressScript - - // All canonicalizations. - All = BCP47 | Legacy | Macro - - // Default is the canonicalization used by Parse, Make and Compose. To - // preserve as much information as possible, canonicalizations that remove - // potentially valuable information are not included. The Matcher is - // designed to recognize similar tags that would be the same if - // they were canonicalized using All. - Default = Deprecated | Legacy - - canonLang = DeprecatedBase | Legacy | Macro - - // TODO: LikelyScript, LikelyRegion: suppress similar to ICU. -) - -// canonicalize returns the canonicalized equivalent of the tag and -// whether there was any change. -func (t Tag) canonicalize(c CanonType) (Tag, bool) { - if c == Raw { - return t, false - } - changed := false - if c&SuppressScript != 0 { - if t.lang < langNoIndexOffset && uint8(t.script) == suppressScript[t.lang] { - t.script = 0 - changed = true - } - } - if c&canonLang != 0 { - for { - if l, aliasType := normLang(t.lang); l != t.lang { - switch aliasType { - case langLegacy: - if c&Legacy != 0 { - if t.lang == _sh && t.script == 0 { - t.script = _Latn - } - t.lang = l - changed = true - } - case langMacro: - if c&Macro != 0 { - // We deviate here from CLDR. The mapping "nb" -> "no" - // qualifies as a typical Macro language mapping. However, - // for legacy reasons, CLDR maps "no", the macro language - // code for Norwegian, to the dominant variant "nb". This - // change is currently under consideration for CLDR as well. - // See http://unicode.org/cldr/trac/ticket/2698 and also - // http://unicode.org/cldr/trac/ticket/1790 for some of the - // practical implications. TODO: this check could be removed - // if CLDR adopts this change. - if c&CLDR == 0 || t.lang != _nb { - changed = true - t.lang = l - } - } - case langDeprecated: - if c&DeprecatedBase != 0 { - if t.lang == _mo && t.region == 0 { - t.region = _MD - } - t.lang = l - changed = true - // Other canonicalization types may still apply. - continue - } - } - } else if c&Legacy != 0 && t.lang == _no && c&CLDR != 0 { - t.lang = _nb - changed = true - } - break - } - } - if c&DeprecatedScript != 0 { - if t.script == _Qaai { - changed = true - t.script = _Zinh - } - } - if c&DeprecatedRegion != 0 { - if r := normRegion(t.region); r != 0 { - changed = true - t.region = r - } - } - return t, changed -} - -// Canonicalize returns the canonicalized equivalent of the tag. -func (c CanonType) Canonicalize(t Tag) (Tag, error) { - t, changed := t.canonicalize(c) - if changed { - t.remakeString() - } - return t, nil -} - -// Confidence indicates the level of certainty for a given return value. -// For example, Serbian may be written in Cyrillic or Latin script. -// The confidence level indicates whether a value was explicitly specified, -// whether it is typically the only possible value, or whether there is -// an ambiguity. -type Confidence int - -const ( - No Confidence = iota // full confidence that there was no match - Low // most likely value picked out of a set of alternatives - High // value is generally assumed to be the correct match - Exact // exact match or explicitly specified value -) - -var confName = []string{"No", "Low", "High", "Exact"} - -func (c Confidence) String() string { - return confName[c] -} - -// remakeString is used to update t.str in case lang, script or region changed. -// It is assumed that pExt and pVariant still point to the start of the -// respective parts. -func (t *Tag) remakeString() { - if t.str == "" { - return - } - extra := t.str[t.pVariant:] - if t.pVariant > 0 { - extra = extra[1:] - } - if t.equalTags(und) && strings.HasPrefix(extra, "x-") { - t.str = extra - t.pVariant = 0 - t.pExt = 0 - return - } - var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. - b := buf[:t.genCoreBytes(buf[:])] - if extra != "" { - diff := len(b) - int(t.pVariant) - b = append(b, '-') - b = append(b, extra...) - t.pVariant = uint8(int(t.pVariant) + diff) - t.pExt = uint16(int(t.pExt) + diff) - } else { - t.pVariant = uint8(len(b)) - t.pExt = uint16(len(b)) - } - t.str = string(b) -} - -// genCoreBytes writes a string for the base languages, script and region tags -// to the given buffer and returns the number of bytes written. It will never -// write more than maxCoreSize bytes. -func (t *Tag) genCoreBytes(buf []byte) int { - n := t.lang.stringToBuf(buf[:]) - if t.script != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.script.String()) - } - if t.region != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.region.String()) - } - return n -} - -// String returns the canonical string representation of the language tag. -func (t Tag) String() string { - if t.str != "" { - return t.str - } - if t.script == 0 && t.region == 0 { - return t.lang.String() - } - buf := [maxCoreSize]byte{} - return string(buf[:t.genCoreBytes(buf[:])]) -} - -// Base returns the base language of the language tag. If the base language is -// unspecified, an attempt will be made to infer it from the context. -// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. -func (t Tag) Base() (Base, Confidence) { - if t.lang != 0 { - return Base{t.lang}, Exact - } - c := High - if t.script == 0 && !(Region{t.region}).IsCountry() { - c = Low - } - if tag, err := addTags(t); err == nil && tag.lang != 0 { - return Base{tag.lang}, c - } - return Base{0}, No -} - -// Script infers the script for the language tag. If it was not explicitly given, it will infer -// a most likely candidate. -// If more than one script is commonly used for a language, the most likely one -// is returned with a low confidence indication. For example, it returns (Cyrl, Low) -// for Serbian. -// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) -// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks -// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. -// See http://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for -// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. -// Note that an inferred script is never guaranteed to be the correct one. Latin is -// almost exclusively used for Afrikaans, but Arabic has been used for some texts -// in the past. Also, the script that is commonly used may change over time. -// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. -func (t Tag) Script() (Script, Confidence) { - if t.script != 0 { - return Script{t.script}, Exact - } - sc, c := scriptID(_Zzzz), No - if t.lang < langNoIndexOffset { - if scr := scriptID(suppressScript[t.lang]); scr != 0 { - // Note: it is not always the case that a language with a suppress - // script value is only written in one script (e.g. kk, ms, pa). - if t.region == 0 { - return Script{scriptID(scr)}, High - } - sc, c = scr, High - } - } - if tag, err := addTags(t); err == nil { - if tag.script != sc { - sc, c = tag.script, Low - } - } else { - t, _ = (Deprecated | Macro).Canonicalize(t) - if tag, err := addTags(t); err == nil && tag.script != sc { - sc, c = tag.script, Low - } - } - return Script{sc}, c -} - -// Region returns the region for the language tag. If it was not explicitly given, it will -// infer a most likely candidate from the context. -// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. -func (t Tag) Region() (Region, Confidence) { - if t.region != 0 { - return Region{t.region}, Exact - } - if t, err := addTags(t); err == nil { - return Region{t.region}, Low // TODO: differentiate between high and low. - } - t, _ = (Deprecated | Macro).Canonicalize(t) - if tag, err := addTags(t); err == nil { - return Region{tag.region}, Low - } - return Region{_ZZ}, No // TODO: return world instead of undetermined? -} - -// Variant returns the variants specified explicitly for this language tag. -// or nil if no variant was specified. -func (t Tag) Variants() []Variant { - v := []Variant{} - if int(t.pVariant) < int(t.pExt) { - for x, str := "", t.str[t.pVariant:t.pExt]; str != ""; { - x, str = nextToken(str) - v = append(v, Variant{x}) - } - } - return v -} - -// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a -// specific language are substituted with fields from the parent language. -// The parent for a language may change for newer versions of CLDR. -func (t Tag) Parent() Tag { - if t.str != "" { - // Strip the variants and extensions. - t, _ = Raw.Compose(t.Raw()) - if t.region == 0 && t.script != 0 && t.lang != 0 { - base, _ := addTags(Tag{lang: t.lang}) - if base.script == t.script { - return Tag{lang: t.lang} - } - } - return t - } - if t.lang != 0 { - if t.region != 0 { - maxScript := t.script - if maxScript == 0 { - max, _ := addTags(t) - maxScript = max.script - } - - for i := range parents { - if langID(parents[i].lang) == t.lang && scriptID(parents[i].maxScript) == maxScript { - for _, r := range parents[i].fromRegion { - if regionID(r) == t.region { - return Tag{ - lang: t.lang, - script: scriptID(parents[i].script), - region: regionID(parents[i].toRegion), - } - } - } - } - } - - // Strip the script if it is the default one. - base, _ := addTags(Tag{lang: t.lang}) - if base.script != maxScript { - return Tag{lang: t.lang, script: maxScript} - } - return Tag{lang: t.lang} - } else if t.script != 0 { - // The parent for an base-script pair with a non-default script is - // "und" instead of the base language. - base, _ := addTags(Tag{lang: t.lang}) - if base.script != t.script { - return und - } - return Tag{lang: t.lang} - } - } - return und -} - -// returns token t and the rest of the string. -func nextToken(s string) (t, tail string) { - p := strings.Index(s[1:], "-") - if p == -1 { - return s[1:], "" - } - p++ - return s[1:p], s[p:] -} - -// Extension is a single BCP 47 extension. -type Extension struct { - s string -} - -// String returns the string representation of the extension, including the -// type tag. -func (e Extension) String() string { - return e.s -} - -// ParseExtension parses s as an extension and returns it on success. -func ParseExtension(s string) (e Extension, err error) { - scan := makeScannerString(s) - var end int - if n := len(scan.token); n != 1 { - return Extension{}, errSyntax - } - scan.toLower(0, len(scan.b)) - end = parseExtension(&scan) - if end != len(s) { - return Extension{}, errSyntax - } - return Extension{string(scan.b)}, nil -} - -// Type returns the one-byte extension type of e. It returns 0 for the zero -// exception. -func (e Extension) Type() byte { - if e.s == "" { - return 0 - } - return e.s[0] -} - -// Tokens returns the list of tokens of e. -func (e Extension) Tokens() []string { - return strings.Split(e.s, "-") -} - -// Extension returns the extension of type x for tag t. It will return -// false for ok if t does not have the requested extension. The returned -// extension will be invalid in this case. -func (t Tag) Extension(x byte) (ext Extension, ok bool) { - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) - if ext[0] == x { - return Extension{ext}, true - } - } - return Extension{}, false -} - -// Extensions returns all extensions of t. -func (t Tag) Extensions() []Extension { - e := []Extension{} - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) - e = append(e, Extension{ext}) - } - return e -} - -// TypeForKey returns the type associated with the given key, where key and type -// are of the allowed values defined for the Unicode locale extension ('u') in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// TypeForKey will traverse the inheritance chain to get the correct value. -func (t Tag) TypeForKey(key string) string { - if start, end, _ := t.findTypeForKey(key); end != start { - return t.str[start:end] - } - return "" -} - -var ( - errPrivateUse = errors.New("cannot set a key on a private use tag") - errInvalidArguments = errors.New("invalid key or type") -) - -// SetTypeForKey returns a new Tag with the key set to type, where key and type -// are of the allowed values defined for the Unicode locale extension ('u') in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// An empty value removes an existing pair with the same key. -func (t Tag) SetTypeForKey(key, value string) (Tag, error) { - if t.private() { - return t, errPrivateUse - } - if len(key) != 2 { - return t, errInvalidArguments - } - - // Remove the setting if value is "". - if value == "" { - start, end, _ := t.findTypeForKey(key) - if start != end { - // Remove key tag and leading '-'. - start -= 4 - - // Remove a possible empty extension. - if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' { - start -= 2 - } - if start == int(t.pVariant) && end == len(t.str) { - t.str = "" - t.pVariant, t.pExt = 0, 0 - } else { - t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) - } - } - return t, nil - } - - if len(value) < 3 || len(value) > 8 { - return t, errInvalidArguments - } - - var ( - buf [maxCoreSize + maxSimpleUExtensionSize]byte - uStart int // start of the -u extension. - ) - - // Generate the tag string if needed. - if t.str == "" { - uStart = t.genCoreBytes(buf[:]) - buf[uStart] = '-' - uStart++ - } - - // Create new key-type pair and parse it to verify. - b := buf[uStart:] - copy(b, "u-") - copy(b[2:], key) - b[4] = '-' - b = b[:5+copy(b[5:], value)] - scan := makeScanner(b) - if parseExtensions(&scan); scan.err != nil { - return t, scan.err - } - - // Assemble the replacement string. - if t.str == "" { - t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) - t.str = string(buf[:uStart+len(b)]) - } else { - s := t.str - start, end, hasExt := t.findTypeForKey(key) - if start == end { - if hasExt { - b = b[2:] - } - t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:]) - } else { - t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:]) - } - } - return t, nil -} - -// findKeyAndType returns the start and end position for the type corresponding -// to key or the point at which to insert the key-value pair if the type -// wasn't found. The hasExt return value reports whether an -u extension was present. -// Note: the extensions are typically very small and are likely to contain -// only one key-type pair. -func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) { - p := int(t.pExt) - if len(key) != 2 || p == len(t.str) || p == 0 { - return p, p, false - } - s := t.str - - // Find the correct extension. - for p++; s[p] != 'u'; p++ { - if s[p] > 'u' { - p-- - return p, p, false - } - if p = nextExtension(s, p); p == len(s) { - return len(s), len(s), false - } - } - // Proceed to the hyphen following the extension name. - p++ - - // curKey is the key currently being processed. - curKey := "" - - // Iterate over keys until we get the end of a section. - for { - // p points to the hyphen preceding the current token. - if p3 := p + 3; s[p3] == '-' { - // Found a key. - // Check whether we just processed the key that was requested. - if curKey == key { - return start, p, true - } - // Set to the next key and continue scanning type tokens. - curKey = s[p+1 : p3] - if curKey > key { - return p, p, true - } - // Start of the type token sequence. - start = p + 4 - // A type is at least 3 characters long. - p += 7 // 4 + 3 - } else { - // Attribute or type, which is at least 3 characters long. - p += 4 - } - // p points past the third character of a type or attribute. - max := p + 5 // maximum length of token plus hyphen. - if len(s) < max { - max = len(s) - } - for ; p < max && s[p] != '-'; p++ { - } - // Bail if we have exhausted all tokens or if the next token starts - // a new extension. - if p == len(s) || s[p+2] == '-' { - if curKey == key { - return start, p, true - } - return p, p, true - } - } -} - -// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags -// for which data exists in the text repository. The index will change over time -// and should not be stored in persistent storage. Extensions, except for the -// 'va' type of the 'u' extension, are ignored. It will return 0, false if no -// compact tag exists, where 0 is the index for the root language (Und). -func CompactIndex(t Tag) (index int, ok bool) { - // TODO: perhaps give more frequent tags a lower index. - // TODO: we could make the indexes stable. This will excluded some - // possibilities for optimization, so don't do this quite yet. - b, s, r := t.Raw() - if len(t.str) > 0 { - if strings.HasPrefix(t.str, "x-") { - // We have no entries for user-defined tags. - return 0, false - } - if uint16(t.pVariant) != t.pExt { - // There are no tags with variants and an u-va type. - if t.TypeForKey("va") != "" { - return 0, false - } - t, _ = Raw.Compose(b, s, r, t.Variants()) - } else if _, ok := t.Extension('u'); ok { - // Strip all but the 'va' entry. - variant := t.TypeForKey("va") - t, _ = Raw.Compose(b, s, r) - t, _ = t.SetTypeForKey("va", variant) - } - if len(t.str) > 0 { - // We have some variants. - for i, s := range specialTags { - if s == t { - return i + 1, true - } - } - return 0, false - } - } - // No variants specified: just compare core components. - // The key has the form lllssrrr, where l, s, and r are nibbles for - // respectively the langID, scriptID, and regionID. - key := uint32(b.langID) << (8 + 12) - key |= uint32(s.scriptID) << 12 - key |= uint32(r.regionID) - x, ok := coreTags[key] - return int(x), ok -} - -// Base is an ISO 639 language code, used for encoding the base language -// of a language tag. -type Base struct { - langID -} - -// ParseBase parses a 2- or 3-letter ISO 639 code. -// It returns a ValueError if s is a well-formed but unknown language identifier -// or another error if another error occurred. -func ParseBase(s string) (Base, error) { - if n := len(s); n < 2 || 3 < n { - return Base{}, errSyntax - } - var buf [3]byte - l, err := getLangID(buf[:copy(buf[:], s)]) - return Base{l}, err -} - -// Script is a 4-letter ISO 15924 code for representing scripts. -// It is idiomatically represented in title case. -type Script struct { - scriptID -} - -// ParseScript parses a 4-letter ISO 15924 code. -// It returns a ValueError if s is a well-formed but unknown script identifier -// or another error if another error occurred. -func ParseScript(s string) (Script, error) { - if len(s) != 4 { - return Script{}, errSyntax - } - var buf [4]byte - sc, err := getScriptID(script, buf[:copy(buf[:], s)]) - return Script{sc}, err -} - -// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. -type Region struct { - regionID -} - -// EncodeM49 returns the Region for the given UN M.49 code. -// It returns an error if r is not a valid code. -func EncodeM49(r int) (Region, error) { - rid, err := getRegionM49(r) - return Region{rid}, err -} - -// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. -// It returns a ValueError if s is a well-formed but unknown region identifier -// or another error if another error occurred. -func ParseRegion(s string) (Region, error) { - if n := len(s); n < 2 || 3 < n { - return Region{}, errSyntax - } - var buf [3]byte - r, err := getRegionID(buf[:copy(buf[:], s)]) - return Region{r}, err -} - -// IsCountry returns whether this region is a country or autonomous area. This -// includes non-standard definitions from CLDR. -func (r Region) IsCountry() bool { - if r.regionID == 0 || r.IsGroup() || r.IsPrivateUse() && r.regionID != _XK { - return false - } - return true -} - -// IsGroup returns whether this region defines a collection of regions. This -// includes non-standard definitions from CLDR. -func (r Region) IsGroup() bool { - if r.regionID == 0 { - return false - } - return int(regionInclusion[r.regionID]) < len(regionContainment) -} - -// Contains returns whether Region c is contained by Region r. It returns true -// if c == r. -func (r Region) Contains(c Region) bool { - return r.regionID.contains(c.regionID) -} - -func (r regionID) contains(c regionID) bool { - if r == c { - return true - } - g := regionInclusion[r] - if g >= nRegionGroups { - return false - } - m := regionContainment[g] - - d := regionInclusion[c] - b := regionInclusionBits[d] - - // A contained country may belong to multiple disjoint groups. Matching any - // of these indicates containment. If the contained region is a group, it - // must strictly be a subset. - if d >= nRegionGroups { - return b&m != 0 - } - return b&^m == 0 -} - -var errNoTLD = errors.New("language: region is not a valid ccTLD") - -// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. -// In all other cases it returns either the region itself or an error. -// -// This method may return an error for a region for which there exists a -// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The -// region will already be canonicalized it was obtained from a Tag that was -// obtained using any of the default methods. -func (r Region) TLD() (Region, error) { - // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the - // difference between ISO 3166-1 and IANA ccTLD. - if r.regionID == _GB { - r = Region{_UK} - } - if (r.typ() & ccTLD) == 0 { - return Region{}, errNoTLD - } - return r, nil -} - -// Canonicalize returns the region or a possible replacement if the region is -// deprecated. It will not return a replacement for deprecated regions that -// are split into multiple regions. -func (r Region) Canonicalize() Region { - if cr := normRegion(r.regionID); cr != 0 { - return Region{cr} - } - return r -} - -// Variant represents a registered variant of a language as defined by BCP 47. -type Variant struct { - variant string -} - -// ParseVariant parses and returns a Variant. An error is returned if s is not -// a valid variant. -func ParseVariant(s string) (Variant, error) { - s = strings.ToLower(s) - if _, ok := variantIndex[s]; ok { - return Variant{s}, nil - } - return Variant{}, mkErrInvalid([]byte(s)) -} - -// String returns the string representation of the variant. -func (v Variant) String() string { - return v.variant -} diff --git a/vendor/golang.org/x/text/language/lookup.go b/vendor/golang.org/x/text/language/lookup.go deleted file mode 100644 index 1d80ac3..0000000 --- a/vendor/golang.org/x/text/language/lookup.go +++ /dev/null @@ -1,396 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "bytes" - "fmt" - "sort" - "strconv" - - "golang.org/x/text/internal/tag" -) - -// findIndex tries to find the given tag in idx and returns a standardized error -// if it could not be found. -func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { - if !tag.FixCase(form, key) { - return 0, errSyntax - } - i := idx.Index(key) - if i == -1 { - return 0, mkErrInvalid(key) - } - return i, nil -} - -func searchUint(imap []uint16, key uint16) int { - return sort.Search(len(imap), func(i int) bool { - return imap[i] >= key - }) -} - -type langID uint16 - -// getLangID returns the langID of s if s is a canonical subtag -// or langUnknown if s is not a canonical subtag. -func getLangID(s []byte) (langID, error) { - if len(s) == 2 { - return getLangISO2(s) - } - return getLangISO3(s) -} - -// mapLang returns the mapped langID of id according to mapping m. -func normLang(id langID) (langID, langAliasType) { - k := sort.Search(len(langAliasMap), func(i int) bool { - return langAliasMap[i].from >= uint16(id) - }) - if k < len(langAliasMap) && langAliasMap[k].from == uint16(id) { - return langID(langAliasMap[k].to), langAliasTypes[k] - } - return id, langAliasTypeUnknown -} - -// getLangISO2 returns the langID for the given 2-letter ISO language code -// or unknownLang if this does not exist. -func getLangISO2(s []byte) (langID, error) { - if !tag.FixCase("zz", s) { - return 0, errSyntax - } - if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { - return langID(i), nil - } - return 0, mkErrInvalid(s) -} - -const base = 'z' - 'a' + 1 - -func strToInt(s []byte) uint { - v := uint(0) - for i := 0; i < len(s); i++ { - v *= base - v += uint(s[i] - 'a') - } - return v -} - -// converts the given integer to the original ASCII string passed to strToInt. -// len(s) must match the number of characters obtained. -func intToStr(v uint, s []byte) { - for i := len(s) - 1; i >= 0; i-- { - s[i] = byte(v%base) + 'a' - v /= base - } -} - -// getLangISO3 returns the langID for the given 3-letter ISO language code -// or unknownLang if this does not exist. -func getLangISO3(s []byte) (langID, error) { - if tag.FixCase("und", s) { - // first try to match canonical 3-letter entries - for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { - if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { - // We treat "und" as special and always translate it to "unspecified". - // Note that ZZ and Zzzz are private use and are not treated as - // unspecified by default. - id := langID(i) - if id == nonCanonicalUnd { - return 0, nil - } - return id, nil - } - } - if i := altLangISO3.Index(s); i != -1 { - return langID(altLangIndex[altLangISO3.Elem(i)[3]]), nil - } - n := strToInt(s) - if langNoIndex[n/8]&(1<<(n%8)) != 0 { - return langID(n) + langNoIndexOffset, nil - } - // Check for non-canonical uses of ISO3. - for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { - if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { - return langID(i), nil - } - } - return 0, mkErrInvalid(s) - } - return 0, errSyntax -} - -// stringToBuf writes the string to b and returns the number of bytes -// written. cap(b) must be >= 3. -func (id langID) stringToBuf(b []byte) int { - if id >= langNoIndexOffset { - intToStr(uint(id)-langNoIndexOffset, b[:3]) - return 3 - } else if id == 0 { - return copy(b, "und") - } - l := lang[id<<2:] - if l[3] == 0 { - return copy(b, l[:3]) - } - return copy(b, l[:2]) -} - -// String returns the BCP 47 representation of the langID. -// Use b as variable name, instead of id, to ensure the variable -// used is consistent with that of Base in which this type is embedded. -func (b langID) String() string { - if b == 0 { - return "und" - } else if b >= langNoIndexOffset { - b -= langNoIndexOffset - buf := [3]byte{} - intToStr(uint(b), buf[:]) - return string(buf[:]) - } - l := lang.Elem(int(b)) - if l[3] == 0 { - return l[:3] - } - return l[:2] -} - -// ISO3 returns the ISO 639-3 language code. -func (b langID) ISO3() string { - if b == 0 || b >= langNoIndexOffset { - return b.String() - } - l := lang.Elem(int(b)) - if l[3] == 0 { - return l[:3] - } else if l[2] == 0 { - return altLangISO3.Elem(int(l[3]))[:3] - } - // This allocation will only happen for 3-letter ISO codes - // that are non-canonical BCP 47 language identifiers. - return l[0:1] + l[2:4] -} - -// IsPrivateUse reports whether this language code is reserved for private use. -func (b langID) IsPrivateUse() bool { - return langPrivateStart <= b && b <= langPrivateEnd -} - -type regionID uint16 - -// getRegionID returns the region id for s if s is a valid 2-letter region code -// or unknownRegion. -func getRegionID(s []byte) (regionID, error) { - if len(s) == 3 { - if isAlpha(s[0]) { - return getRegionISO3(s) - } - if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { - return getRegionM49(int(i)) - } - } - return getRegionISO2(s) -} - -// getRegionISO2 returns the regionID for the given 2-letter ISO country code -// or unknownRegion if this does not exist. -func getRegionISO2(s []byte) (regionID, error) { - i, err := findIndex(regionISO, s, "ZZ") - if err != nil { - return 0, err - } - return regionID(i) + isoRegionOffset, nil -} - -// getRegionISO3 returns the regionID for the given 3-letter ISO country code -// or unknownRegion if this does not exist. -func getRegionISO3(s []byte) (regionID, error) { - if tag.FixCase("ZZZ", s) { - for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { - if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { - return regionID(i) + isoRegionOffset, nil - } - } - for i := 0; i < len(altRegionISO3); i += 3 { - if tag.Compare(altRegionISO3[i:i+3], s) == 0 { - return regionID(altRegionIDs[i/3]), nil - } - } - return 0, mkErrInvalid(s) - } - return 0, errSyntax -} - -func getRegionM49(n int) (regionID, error) { - if 0 < n && n <= 999 { - const ( - searchBits = 7 - regionBits = 9 - regionMask = 1<<regionBits - 1 - ) - idx := n >> searchBits - buf := fromM49[m49Index[idx]:m49Index[idx+1]] - val := uint16(n) << regionBits // we rely on bits shifting out - i := sort.Search(len(buf), func(i int) bool { - return buf[i] >= val - }) - if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { - return regionID(r & regionMask), nil - } - } - var e ValueError - fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) - return 0, e -} - -// normRegion returns a region if r is deprecated or 0 otherwise. -// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). -// TODO: consider mapping split up regions to new most populous one (like CLDR). -func normRegion(r regionID) regionID { - m := regionOldMap - k := sort.Search(len(m), func(i int) bool { - return m[i].from >= uint16(r) - }) - if k < len(m) && m[k].from == uint16(r) { - return regionID(m[k].to) - } - return 0 -} - -const ( - iso3166UserAssigned = 1 << iota - ccTLD - bcp47Region -) - -func (r regionID) typ() byte { - return regionTypes[r] -} - -// String returns the BCP 47 representation for the region. -// It returns "ZZ" for an unspecified region. -func (r regionID) String() string { - if r < isoRegionOffset { - if r == 0 { - return "ZZ" - } - return fmt.Sprintf("%03d", r.M49()) - } - r -= isoRegionOffset - return regionISO.Elem(int(r))[:2] -} - -// ISO3 returns the 3-letter ISO code of r. -// Note that not all regions have a 3-letter ISO code. -// In such cases this method returns "ZZZ". -func (r regionID) ISO3() string { - if r < isoRegionOffset { - return "ZZZ" - } - r -= isoRegionOffset - reg := regionISO.Elem(int(r)) - switch reg[2] { - case 0: - return altRegionISO3[reg[3]:][:3] - case ' ': - return "ZZZ" - } - return reg[0:1] + reg[2:4] -} - -// M49 returns the UN M.49 encoding of r, or 0 if this encoding -// is not defined for r. -func (r regionID) M49() int { - return int(m49[r]) -} - -// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This -// may include private-use tags that are assigned by CLDR and used in this -// implementation. So IsPrivateUse and IsCountry can be simultaneously true. -func (r regionID) IsPrivateUse() bool { - return r.typ()&iso3166UserAssigned != 0 -} - -type scriptID uint8 - -// getScriptID returns the script id for string s. It assumes that s -// is of the format [A-Z][a-z]{3}. -func getScriptID(idx tag.Index, s []byte) (scriptID, error) { - i, err := findIndex(idx, s, "Zzzz") - return scriptID(i), err -} - -// String returns the script code in title case. -// It returns "Zzzz" for an unspecified script. -func (s scriptID) String() string { - if s == 0 { - return "Zzzz" - } - return script.Elem(int(s)) -} - -// IsPrivateUse reports whether this script code is reserved for private use. -func (s scriptID) IsPrivateUse() bool { - return _Qaaa <= s && s <= _Qabx -} - -const ( - maxAltTaglen = len("en-US-POSIX") - maxLen = maxAltTaglen -) - -var ( - // grandfatheredMap holds a mapping from legacy and grandfathered tags to - // their base language or index to more elaborate tag. - grandfatheredMap = map[[maxLen]byte]int16{ - [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban - [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami - [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn - [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak - [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon - [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux - [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo - [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn - [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao - [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay - [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu - [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok - [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn - [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR - [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL - [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE - [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu - [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka - [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan - [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang - - // Grandfathered tags with no modern replacement will be converted as - // follows: - [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish - [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed - [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default - [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian - [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo - [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min - - // CLDR-specific tag. - [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root - [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" - } - - altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} - - altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" -) - -func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { - if v, ok := grandfatheredMap[s]; ok { - if v < 0 { - return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true - } - t.lang = langID(v) - return t, true - } - return t, false -} diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go deleted file mode 100644 index 15b74d1..0000000 --- a/vendor/golang.org/x/text/language/match.go +++ /dev/null @@ -1,933 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import "errors" - -// A MatchOption configures a Matcher. -type MatchOption func(*matcher) - -// PreferSameScript will, in the absence of a match, result in the first -// preferred tag with the same script as a supported tag to match this supported -// tag. The default is currently true, but this may change in the future. -func PreferSameScript(preferSame bool) MatchOption { - return func(m *matcher) { m.preferSameScript = preferSame } -} - -// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface. -// There doesn't seem to be too much need for multiple types. -// Making it a concrete type allows MatchStrings to be a method, which will -// improve its discoverability. - -// MatchStrings parses and matches the given strings until one of them matches -// the language in the Matcher. A string may be an Accept-Language header as -// handled by ParseAcceptLanguage. The default language is returned if no -// other language matched. -func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) { - for _, accept := range lang { - desired, _, err := ParseAcceptLanguage(accept) - if err != nil { - continue - } - if tag, index, conf := m.Match(desired...); conf != No { - return tag, index - } - } - tag, index, _ = m.Match() - return -} - -// Matcher is the interface that wraps the Match method. -// -// Match returns the best match for any of the given tags, along with -// a unique index associated with the returned tag and a confidence -// score. -type Matcher interface { - Match(t ...Tag) (tag Tag, index int, c Confidence) -} - -// Comprehends reports the confidence score for a speaker of a given language -// to being able to comprehend the written form of an alternative language. -func Comprehends(speaker, alternative Tag) Confidence { - _, _, c := NewMatcher([]Tag{alternative}).Match(speaker) - return c -} - -// NewMatcher returns a Matcher that matches an ordered list of preferred tags -// against a list of supported tags based on written intelligibility, closeness -// of dialect, equivalence of subtags and various other rules. It is initialized -// with the list of supported tags. The first element is used as the default -// value in case no match is found. -// -// Its Match method matches the first of the given Tags to reach a certain -// confidence threshold. The tags passed to Match should therefore be specified -// in order of preference. Extensions are ignored for matching. -// -// The index returned by the Match method corresponds to the index of the -// matched tag in t, but is augmented with the Unicode extension ('u')of the -// corresponding preferred tag. This allows user locale options to be passed -// transparently. -func NewMatcher(t []Tag, options ...MatchOption) Matcher { - return newMatcher(t, options) -} - -func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { - match, w, c := m.getBest(want...) - if match != nil { - t, index = match.tag, match.index - } else { - // TODO: this should be an option - t = m.default_.tag - if m.preferSameScript { - outer: - for _, w := range want { - script, _ := w.Script() - if script.scriptID == 0 { - // Don't do anything if there is no script, such as with - // private subtags. - continue - } - for i, h := range m.supported { - if script.scriptID == h.maxScript { - t, index = h.tag, i - break outer - } - } - } - } - // TODO: select first language tag based on script. - } - if w.region != 0 && t.region != 0 && t.region.contains(w.region) { - t, _ = Raw.Compose(t, Region{w.region}) - } - // Copy options from the user-provided tag into the result tag. This is hard - // to do after the fact, so we do it here. - // TODO: add in alternative variants to -u-va-. - // TODO: add preferred region to -u-rg-. - if e := w.Extensions(); len(e) > 0 { - t, _ = Raw.Compose(t, e) - } - return t, index, c -} - -type scriptRegionFlags uint8 - -const ( - isList = 1 << iota - scriptInFrom - regionInFrom -) - -func (t *Tag) setUndefinedLang(id langID) { - if t.lang == 0 { - t.lang = id - } -} - -func (t *Tag) setUndefinedScript(id scriptID) { - if t.script == 0 { - t.script = id - } -} - -func (t *Tag) setUndefinedRegion(id regionID) { - if t.region == 0 || t.region.contains(id) { - t.region = id - } -} - -// ErrMissingLikelyTagsData indicates no information was available -// to compute likely values of missing tags. -var ErrMissingLikelyTagsData = errors.New("missing likely tags data") - -// addLikelySubtags sets subtags to their most likely value, given the locale. -// In most cases this means setting fields for unknown values, but in some -// cases it may alter a value. It returns an ErrMissingLikelyTagsData error -// if the given locale cannot be expanded. -func (t Tag) addLikelySubtags() (Tag, error) { - id, err := addTags(t) - if err != nil { - return t, err - } else if id.equalTags(t) { - return t, nil - } - id.remakeString() - return id, nil -} - -// specializeRegion attempts to specialize a group region. -func specializeRegion(t *Tag) bool { - if i := regionInclusion[t.region]; i < nRegionGroups { - x := likelyRegionGroup[i] - if langID(x.lang) == t.lang && scriptID(x.script) == t.script { - t.region = regionID(x.region) - } - return true - } - return false -} - -func addTags(t Tag) (Tag, error) { - // We leave private use identifiers alone. - if t.private() { - return t, nil - } - if t.script != 0 && t.region != 0 { - if t.lang != 0 { - // already fully specified - specializeRegion(&t) - return t, nil - } - // Search matches for und-script-region. Note that for these cases - // region will never be a group so there is no need to check for this. - list := likelyRegion[t.region : t.region+1] - if x := list[0]; x.flags&isList != 0 { - list = likelyRegionList[x.lang : x.lang+uint16(x.script)] - } - for _, x := range list { - // Deviating from the spec. See match_test.go for details. - if scriptID(x.script) == t.script { - t.setUndefinedLang(langID(x.lang)) - return t, nil - } - } - } - if t.lang != 0 { - // Search matches for lang-script and lang-region, where lang != und. - if t.lang < langNoIndexOffset { - x := likelyLang[t.lang] - if x.flags&isList != 0 { - list := likelyLangList[x.region : x.region+uint16(x.script)] - if t.script != 0 { - for _, x := range list { - if scriptID(x.script) == t.script && x.flags&scriptInFrom != 0 { - t.setUndefinedRegion(regionID(x.region)) - return t, nil - } - } - } else if t.region != 0 { - count := 0 - goodScript := true - tt := t - for _, x := range list { - // We visit all entries for which the script was not - // defined, including the ones where the region was not - // defined. This allows for proper disambiguation within - // regions. - if x.flags&scriptInFrom == 0 && t.region.contains(regionID(x.region)) { - tt.region = regionID(x.region) - tt.setUndefinedScript(scriptID(x.script)) - goodScript = goodScript && tt.script == scriptID(x.script) - count++ - } - } - if count == 1 { - return tt, nil - } - // Even if we fail to find a unique Region, we might have - // an unambiguous script. - if goodScript { - t.script = tt.script - } - } - } - } - } else { - // Search matches for und-script. - if t.script != 0 { - x := likelyScript[t.script] - if x.region != 0 { - t.setUndefinedRegion(regionID(x.region)) - t.setUndefinedLang(langID(x.lang)) - return t, nil - } - } - // Search matches for und-region. If und-script-region exists, it would - // have been found earlier. - if t.region != 0 { - if i := regionInclusion[t.region]; i < nRegionGroups { - x := likelyRegionGroup[i] - if x.region != 0 { - t.setUndefinedLang(langID(x.lang)) - t.setUndefinedScript(scriptID(x.script)) - t.region = regionID(x.region) - } - } else { - x := likelyRegion[t.region] - if x.flags&isList != 0 { - x = likelyRegionList[x.lang] - } - if x.script != 0 && x.flags != scriptInFrom { - t.setUndefinedLang(langID(x.lang)) - t.setUndefinedScript(scriptID(x.script)) - return t, nil - } - } - } - } - - // Search matches for lang. - if t.lang < langNoIndexOffset { - x := likelyLang[t.lang] - if x.flags&isList != 0 { - x = likelyLangList[x.region] - } - if x.region != 0 { - t.setUndefinedScript(scriptID(x.script)) - t.setUndefinedRegion(regionID(x.region)) - } - specializeRegion(&t) - if t.lang == 0 { - t.lang = _en // default language - } - return t, nil - } - return t, ErrMissingLikelyTagsData -} - -func (t *Tag) setTagsFrom(id Tag) { - t.lang = id.lang - t.script = id.script - t.region = id.region -} - -// minimize removes the region or script subtags from t such that -// t.addLikelySubtags() == t.minimize().addLikelySubtags(). -func (t Tag) minimize() (Tag, error) { - t, err := minimizeTags(t) - if err != nil { - return t, err - } - t.remakeString() - return t, nil -} - -// minimizeTags mimics the behavior of the ICU 51 C implementation. -func minimizeTags(t Tag) (Tag, error) { - if t.equalTags(und) { - return t, nil - } - max, err := addTags(t) - if err != nil { - return t, err - } - for _, id := range [...]Tag{ - {lang: t.lang}, - {lang: t.lang, region: t.region}, - {lang: t.lang, script: t.script}, - } { - if x, err := addTags(id); err == nil && max.equalTags(x) { - t.setTagsFrom(id) - break - } - } - return t, nil -} - -// Tag Matching -// CLDR defines an algorithm for finding the best match between two sets of language -// tags. The basic algorithm defines how to score a possible match and then find -// the match with the best score -// (see http://www.unicode.org/reports/tr35/#LanguageMatching). -// Using scoring has several disadvantages. The scoring obfuscates the importance of -// the various factors considered, making the algorithm harder to understand. Using -// scoring also requires the full score to be computed for each pair of tags. -// -// We will use a different algorithm which aims to have the following properties: -// - clarity on the precedence of the various selection factors, and -// - improved performance by allowing early termination of a comparison. -// -// Matching algorithm (overview) -// Input: -// - supported: a set of supported tags -// - default: the default tag to return in case there is no match -// - desired: list of desired tags, ordered by preference, starting with -// the most-preferred. -// -// Algorithm: -// 1) Set the best match to the lowest confidence level -// 2) For each tag in "desired": -// a) For each tag in "supported": -// 1) compute the match between the two tags. -// 2) if the match is better than the previous best match, replace it -// with the new match. (see next section) -// b) if the current best match is Exact and pin is true the result will be -// frozen to the language found thusfar, although better matches may -// still be found for the same language. -// 3) If the best match so far is below a certain threshold, return "default". -// -// Ranking: -// We use two phases to determine whether one pair of tags are a better match -// than another pair of tags. First, we determine a rough confidence level. If the -// levels are different, the one with the highest confidence wins. -// Second, if the rough confidence levels are identical, we use a set of tie-breaker -// rules. -// -// The confidence level of matching a pair of tags is determined by finding the -// lowest confidence level of any matches of the corresponding subtags (the -// result is deemed as good as its weakest link). -// We define the following levels: -// Exact - An exact match of a subtag, before adding likely subtags. -// MaxExact - An exact match of a subtag, after adding likely subtags. -// [See Note 2]. -// High - High level of mutual intelligibility between different subtag -// variants. -// Low - Low level of mutual intelligibility between different subtag -// variants. -// No - No mutual intelligibility. -// -// The following levels can occur for each type of subtag: -// Base: Exact, MaxExact, High, Low, No -// Script: Exact, MaxExact [see Note 3], Low, No -// Region: Exact, MaxExact, High -// Variant: Exact, High -// Private: Exact, No -// -// Any result with a confidence level of Low or higher is deemed a possible match. -// Once a desired tag matches any of the supported tags with a level of MaxExact -// or higher, the next desired tag is not considered (see Step 2.b). -// Note that CLDR provides languageMatching data that defines close equivalence -// classes for base languages, scripts and regions. -// -// Tie-breaking -// If we get the same confidence level for two matches, we apply a sequence of -// tie-breaking rules. The first that succeeds defines the result. The rules are -// applied in the following order. -// 1) Original language was defined and was identical. -// 2) Original region was defined and was identical. -// 3) Distance between two maximized regions was the smallest. -// 4) Original script was defined and was identical. -// 5) Distance from want tag to have tag using the parent relation [see Note 5.] -// If there is still no winner after these rules are applied, the first match -// found wins. -// -// Notes: -// [2] In practice, as matching of Exact is done in a separate phase from -// matching the other levels, we reuse the Exact level to mean MaxExact in -// the second phase. As a consequence, we only need the levels defined by -// the Confidence type. The MaxExact confidence level is mapped to High in -// the public API. -// [3] We do not differentiate between maximized script values that were derived -// from suppressScript versus most likely tag data. We determined that in -// ranking the two, one ranks just after the other. Moreover, the two cannot -// occur concurrently. As a consequence, they are identical for practical -// purposes. -// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign -// the MaxExact level to allow iw vs he to still be a closer match than -// en-AU vs en-US, for example. -// [5] In CLDR a locale inherits fields that are unspecified for this locale -// from its parent. Therefore, if a locale is a parent of another locale, -// it is a strong measure for closeness, especially when no other tie -// breaker rule applies. One could also argue it is inconsistent, for -// example, when pt-AO matches pt (which CLDR equates with pt-BR), even -// though its parent is pt-PT according to the inheritance rules. -// -// Implementation Details: -// There are several performance considerations worth pointing out. Most notably, -// we preprocess as much as possible (within reason) at the time of creation of a -// matcher. This includes: -// - creating a per-language map, which includes data for the raw base language -// and its canonicalized variant (if applicable), -// - expanding entries for the equivalence classes defined in CLDR's -// languageMatch data. -// The per-language map ensures that typically only a very small number of tags -// need to be considered. The pre-expansion of canonicalized subtags and -// equivalence classes reduces the amount of map lookups that need to be done at -// runtime. - -// matcher keeps a set of supported language tags, indexed by language. -type matcher struct { - default_ *haveTag - supported []*haveTag - index map[langID]*matchHeader - passSettings bool - preferSameScript bool -} - -// matchHeader has the lists of tags for exact matches and matches based on -// maximized and canonicalized tags for a given language. -type matchHeader struct { - haveTags []*haveTag - original bool -} - -// haveTag holds a supported Tag and its maximized script and region. The maximized -// or canonicalized language is not stored as it is not needed during matching. -type haveTag struct { - tag Tag - - // index of this tag in the original list of supported tags. - index int - - // conf is the maximum confidence that can result from matching this haveTag. - // When conf < Exact this means it was inserted after applying a CLDR equivalence rule. - conf Confidence - - // Maximized region and script. - maxRegion regionID - maxScript scriptID - - // altScript may be checked as an alternative match to maxScript. If altScript - // matches, the confidence level for this match is Low. Theoretically there - // could be multiple alternative scripts. This does not occur in practice. - altScript scriptID - - // nextMax is the index of the next haveTag with the same maximized tags. - nextMax uint16 -} - -func makeHaveTag(tag Tag, index int) (haveTag, langID) { - max := tag - if tag.lang != 0 || tag.region != 0 || tag.script != 0 { - max, _ = max.canonicalize(All) - max, _ = addTags(max) - max.remakeString() - } - return haveTag{tag, index, Exact, max.region, max.script, altScript(max.lang, max.script), 0}, max.lang -} - -// altScript returns an alternative script that may match the given script with -// a low confidence. At the moment, the langMatch data allows for at most one -// script to map to another and we rely on this to keep the code simple. -func altScript(l langID, s scriptID) scriptID { - for _, alt := range matchScript { - // TODO: also match cases where language is not the same. - if (langID(alt.wantLang) == l || langID(alt.haveLang) == l) && - scriptID(alt.haveScript) == s { - return scriptID(alt.wantScript) - } - } - return 0 -} - -// addIfNew adds a haveTag to the list of tags only if it is a unique tag. -// Tags that have the same maximized values are linked by index. -func (h *matchHeader) addIfNew(n haveTag, exact bool) { - h.original = h.original || exact - // Don't add new exact matches. - for _, v := range h.haveTags { - if v.tag.equalsRest(n.tag) { - return - } - } - // Allow duplicate maximized tags, but create a linked list to allow quickly - // comparing the equivalents and bail out. - for i, v := range h.haveTags { - if v.maxScript == n.maxScript && - v.maxRegion == n.maxRegion && - v.tag.variantOrPrivateTagStr() == n.tag.variantOrPrivateTagStr() { - for h.haveTags[i].nextMax != 0 { - i = int(h.haveTags[i].nextMax) - } - h.haveTags[i].nextMax = uint16(len(h.haveTags)) - break - } - } - h.haveTags = append(h.haveTags, &n) -} - -// header returns the matchHeader for the given language. It creates one if -// it doesn't already exist. -func (m *matcher) header(l langID) *matchHeader { - if h := m.index[l]; h != nil { - return h - } - h := &matchHeader{} - m.index[l] = h - return h -} - -func toConf(d uint8) Confidence { - if d <= 10 { - return High - } - if d < 30 { - return Low - } - return No -} - -// newMatcher builds an index for the given supported tags and returns it as -// a matcher. It also expands the index by considering various equivalence classes -// for a given tag. -func newMatcher(supported []Tag, options []MatchOption) *matcher { - m := &matcher{ - index: make(map[langID]*matchHeader), - preferSameScript: true, - } - for _, o := range options { - o(m) - } - if len(supported) == 0 { - m.default_ = &haveTag{} - return m - } - // Add supported languages to the index. Add exact matches first to give - // them precedence. - for i, tag := range supported { - pair, _ := makeHaveTag(tag, i) - m.header(tag.lang).addIfNew(pair, true) - m.supported = append(m.supported, &pair) - } - m.default_ = m.header(supported[0].lang).haveTags[0] - // Keep these in two different loops to support the case that two equivalent - // languages are distinguished, such as iw and he. - for i, tag := range supported { - pair, max := makeHaveTag(tag, i) - if max != tag.lang { - m.header(max).addIfNew(pair, true) - } - } - - // update is used to add indexes in the map for equivalent languages. - // update will only add entries to original indexes, thus not computing any - // transitive relations. - update := func(want, have uint16, conf Confidence) { - if hh := m.index[langID(have)]; hh != nil { - if !hh.original { - return - } - hw := m.header(langID(want)) - for _, ht := range hh.haveTags { - v := *ht - if conf < v.conf { - v.conf = conf - } - v.nextMax = 0 // this value needs to be recomputed - if v.altScript != 0 { - v.altScript = altScript(langID(want), v.maxScript) - } - hw.addIfNew(v, conf == Exact && hh.original) - } - } - } - - // Add entries for languages with mutual intelligibility as defined by CLDR's - // languageMatch data. - for _, ml := range matchLang { - update(ml.want, ml.have, toConf(ml.distance)) - if !ml.oneway { - update(ml.have, ml.want, toConf(ml.distance)) - } - } - - // Add entries for possible canonicalizations. This is an optimization to - // ensure that only one map lookup needs to be done at runtime per desired tag. - // First we match deprecated equivalents. If they are perfect equivalents - // (their canonicalization simply substitutes a different language code, but - // nothing else), the match confidence is Exact, otherwise it is High. - for i, lm := range langAliasMap { - // If deprecated codes match and there is no fiddling with the script or - // or region, we consider it an exact match. - conf := Exact - if langAliasTypes[i] != langMacro { - if !isExactEquivalent(langID(lm.from)) { - conf = High - } - update(lm.to, lm.from, conf) - } - update(lm.from, lm.to, conf) - } - return m -} - -// getBest gets the best matching tag in m for any of the given tags, taking into -// account the order of preference of the given tags. -func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { - best := bestMatch{} - for i, w := range want { - var max Tag - // Check for exact match first. - h := m.index[w.lang] - if w.lang != 0 { - if h == nil { - continue - } - // Base language is defined. - max, _ = w.canonicalize(Legacy | Deprecated | Macro) - // A region that is added through canonicalization is stronger than - // a maximized region: set it in the original (e.g. mo -> ro-MD). - if w.region != max.region { - w.region = max.region - } - // TODO: should we do the same for scripts? - // See test case: en, sr, nl ; sh ; sr - max, _ = addTags(max) - } else { - // Base language is not defined. - if h != nil { - for i := range h.haveTags { - have := h.haveTags[i] - if have.tag.equalsRest(w) { - return have, w, Exact - } - } - } - if w.script == 0 && w.region == 0 { - // We skip all tags matching und for approximate matching, including - // private tags. - continue - } - max, _ = addTags(w) - if h = m.index[max.lang]; h == nil { - continue - } - } - pin := true - for _, t := range want[i+1:] { - if w.lang == t.lang { - pin = false - break - } - } - // Check for match based on maximized tag. - for i := range h.haveTags { - have := h.haveTags[i] - best.update(have, w, max.script, max.region, pin) - if best.conf == Exact { - for have.nextMax != 0 { - have = h.haveTags[have.nextMax] - best.update(have, w, max.script, max.region, pin) - } - return best.have, best.want, best.conf - } - } - } - if best.conf <= No { - if len(want) != 0 { - return nil, want[0], No - } - return nil, Tag{}, No - } - return best.have, best.want, best.conf -} - -// bestMatch accumulates the best match so far. -type bestMatch struct { - have *haveTag - want Tag - conf Confidence - pinnedRegion regionID - pinLanguage bool - sameRegionGroup bool - // Cached results from applying tie-breaking rules. - origLang bool - origReg bool - paradigmReg bool - regGroupDist uint8 - origScript bool -} - -// update updates the existing best match if the new pair is considered to be a -// better match. To determine if the given pair is a better match, it first -// computes the rough confidence level. If this surpasses the current match, it -// will replace it and update the tie-breaker rule cache. If there is a tie, it -// proceeds with applying a series of tie-breaker rules. If there is no -// conclusive winner after applying the tie-breaker rules, it leaves the current -// match as the preferred match. -// -// If pin is true and have and tag are a strong match, it will henceforth only -// consider matches for this language. This corresponds to the nothing that most -// users have a strong preference for the first defined language. A user can -// still prefer a second language over a dialect of the preferred language by -// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should -// be false. -func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion regionID, pin bool) { - // Bail if the maximum attainable confidence is below that of the current best match. - c := have.conf - if c < m.conf { - return - } - // Don't change the language once we already have found an exact match. - if m.pinLanguage && tag.lang != m.want.lang { - return - } - // Pin the region group if we are comparing tags for the same language. - if tag.lang == m.want.lang && m.sameRegionGroup { - _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.lang) - if !sameGroup { - return - } - } - if c == Exact && have.maxScript == maxScript { - // If there is another language and then another entry of this language, - // don't pin anything, otherwise pin the language. - m.pinLanguage = pin - } - if have.tag.equalsRest(tag) { - } else if have.maxScript != maxScript { - // There is usually very little comprehension between different scripts. - // In a few cases there may still be Low comprehension. This possibility - // is pre-computed and stored in have.altScript. - if Low < m.conf || have.altScript != maxScript { - return - } - c = Low - } else if have.maxRegion != maxRegion { - if High < c { - // There is usually a small difference between languages across regions. - c = High - } - } - - // We store the results of the computations of the tie-breaker rules along - // with the best match. There is no need to do the checks once we determine - // we have a winner, but we do still need to do the tie-breaker computations. - // We use "beaten" to keep track if we still need to do the checks. - beaten := false // true if the new pair defeats the current one. - if c != m.conf { - if c < m.conf { - return - } - beaten = true - } - - // Tie-breaker rules: - // We prefer if the pre-maximized language was specified and identical. - origLang := have.tag.lang == tag.lang && tag.lang != 0 - if !beaten && m.origLang != origLang { - if m.origLang { - return - } - beaten = true - } - - // We prefer if the pre-maximized region was specified and identical. - origReg := have.tag.region == tag.region && tag.region != 0 - if !beaten && m.origReg != origReg { - if m.origReg { - return - } - beaten = true - } - - regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.lang) - if !beaten && m.regGroupDist != regGroupDist { - if regGroupDist > m.regGroupDist { - return - } - beaten = true - } - - paradigmReg := isParadigmLocale(tag.lang, have.maxRegion) - if !beaten && m.paradigmReg != paradigmReg { - if !paradigmReg { - return - } - beaten = true - } - - // Next we prefer if the pre-maximized script was specified and identical. - origScript := have.tag.script == tag.script && tag.script != 0 - if !beaten && m.origScript != origScript { - if m.origScript { - return - } - beaten = true - } - - // Update m to the newly found best match. - if beaten { - m.have = have - m.want = tag - m.conf = c - m.pinnedRegion = maxRegion - m.sameRegionGroup = sameGroup - m.origLang = origLang - m.origReg = origReg - m.paradigmReg = paradigmReg - m.origScript = origScript - m.regGroupDist = regGroupDist - } -} - -func isParadigmLocale(lang langID, r regionID) bool { - for _, e := range paradigmLocales { - if langID(e[0]) == lang && (r == regionID(e[1]) || r == regionID(e[2])) { - return true - } - } - return false -} - -// regionGroupDist computes the distance between two regions based on their -// CLDR grouping. -func regionGroupDist(a, b regionID, script scriptID, lang langID) (dist uint8, same bool) { - const defaultDistance = 4 - - aGroup := uint(regionToGroups[a]) << 1 - bGroup := uint(regionToGroups[b]) << 1 - for _, ri := range matchRegion { - if langID(ri.lang) == lang && (ri.script == 0 || scriptID(ri.script) == script) { - group := uint(1 << (ri.group &^ 0x80)) - if 0x80&ri.group == 0 { - if aGroup&bGroup&group != 0 { // Both regions are in the group. - return ri.distance, ri.distance == defaultDistance - } - } else { - if (aGroup|bGroup)&group == 0 { // Both regions are not in the group. - return ri.distance, ri.distance == defaultDistance - } - } - } - } - return defaultDistance, true -} - -func (t Tag) variants() string { - if t.pVariant == 0 { - return "" - } - return t.str[t.pVariant:t.pExt] -} - -// variantOrPrivateTagStr returns variants or private use tags. -func (t Tag) variantOrPrivateTagStr() string { - if t.pExt > 0 { - return t.str[t.pVariant:t.pExt] - } - return t.str[t.pVariant:] -} - -// equalsRest compares everything except the language. -func (a Tag) equalsRest(b Tag) bool { - // TODO: don't include extensions in this comparison. To do this efficiently, - // though, we should handle private tags separately. - return a.script == b.script && a.region == b.region && a.variantOrPrivateTagStr() == b.variantOrPrivateTagStr() -} - -// isExactEquivalent returns true if canonicalizing the language will not alter -// the script or region of a tag. -func isExactEquivalent(l langID) bool { - for _, o := range notEquivalent { - if o == l { - return false - } - } - return true -} - -var notEquivalent []langID - -func init() { - // Create a list of all languages for which canonicalization may alter the - // script or region. - for _, lm := range langAliasMap { - tag := Tag{lang: langID(lm.from)} - if tag, _ = tag.canonicalize(All); tag.script != 0 || tag.region != 0 { - notEquivalent = append(notEquivalent, langID(lm.from)) - } - } - // Maximize undefined regions of paradigm locales. - for i, v := range paradigmLocales { - max, _ := addTags(Tag{lang: langID(v[0])}) - if v[1] == 0 { - paradigmLocales[i][1] = uint16(max.region) - } - if v[2] == 0 { - paradigmLocales[i][2] = uint16(max.region) - } - } -} diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go deleted file mode 100644 index fca2d30..0000000 --- a/vendor/golang.org/x/text/language/parse.go +++ /dev/null @@ -1,859 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "bytes" - "errors" - "fmt" - "sort" - "strconv" - "strings" - - "golang.org/x/text/internal/tag" -) - -// isAlpha returns true if the byte is not a digit. -// b must be an ASCII letter or digit. -func isAlpha(b byte) bool { - return b > '9' -} - -// isAlphaNum returns true if the string contains only ASCII letters or digits. -func isAlphaNum(s []byte) bool { - for _, c := range s { - if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { - return false - } - } - return true -} - -// errSyntax is returned by any of the parsing functions when the -// input is not well-formed, according to BCP 47. -// TODO: return the position at which the syntax error occurred? -var errSyntax = errors.New("language: tag is not well-formed") - -// ValueError is returned by any of the parsing functions when the -// input is well-formed but the respective subtag is not recognized -// as a valid value. -type ValueError struct { - v [8]byte -} - -func mkErrInvalid(s []byte) error { - var e ValueError - copy(e.v[:], s) - return e -} - -func (e ValueError) tag() []byte { - n := bytes.IndexByte(e.v[:], 0) - if n == -1 { - n = 8 - } - return e.v[:n] -} - -// Error implements the error interface. -func (e ValueError) Error() string { - return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) -} - -// Subtag returns the subtag for which the error occurred. -func (e ValueError) Subtag() string { - return string(e.tag()) -} - -// scanner is used to scan BCP 47 tokens, which are separated by _ or -. -type scanner struct { - b []byte - bytes [max99thPercentileSize]byte - token []byte - start int // start position of the current token - end int // end position of the current token - next int // next point for scan - err error - done bool -} - -func makeScannerString(s string) scanner { - scan := scanner{} - if len(s) <= len(scan.bytes) { - scan.b = scan.bytes[:copy(scan.bytes[:], s)] - } else { - scan.b = []byte(s) - } - scan.init() - return scan -} - -// makeScanner returns a scanner using b as the input buffer. -// b is not copied and may be modified by the scanner routines. -func makeScanner(b []byte) scanner { - scan := scanner{b: b} - scan.init() - return scan -} - -func (s *scanner) init() { - for i, c := range s.b { - if c == '_' { - s.b[i] = '-' - } - } - s.scan() -} - -// restToLower converts the string between start and end to lower case. -func (s *scanner) toLower(start, end int) { - for i := start; i < end; i++ { - c := s.b[i] - if 'A' <= c && c <= 'Z' { - s.b[i] += 'a' - 'A' - } - } -} - -func (s *scanner) setError(e error) { - if s.err == nil || (e == errSyntax && s.err != errSyntax) { - s.err = e - } -} - -// resizeRange shrinks or grows the array at position oldStart such that -// a new string of size newSize can fit between oldStart and oldEnd. -// Sets the scan point to after the resized range. -func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { - s.start = oldStart - if end := oldStart + newSize; end != oldEnd { - diff := end - oldEnd - if end < cap(s.b) { - b := make([]byte, len(s.b)+diff) - copy(b, s.b[:oldStart]) - copy(b[end:], s.b[oldEnd:]) - s.b = b - } else { - s.b = append(s.b[end:], s.b[oldEnd:]...) - } - s.next = end + (s.next - s.end) - s.end = end - } -} - -// replace replaces the current token with repl. -func (s *scanner) replace(repl string) { - s.resizeRange(s.start, s.end, len(repl)) - copy(s.b[s.start:], repl) -} - -// gobble removes the current token from the input. -// Caller must call scan after calling gobble. -func (s *scanner) gobble(e error) { - s.setError(e) - if s.start == 0 { - s.b = s.b[:+copy(s.b, s.b[s.next:])] - s.end = 0 - } else { - s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] - s.end = s.start - 1 - } - s.next = s.start -} - -// deleteRange removes the given range from s.b before the current token. -func (s *scanner) deleteRange(start, end int) { - s.setError(errSyntax) - s.b = s.b[:start+copy(s.b[start:], s.b[end:])] - diff := end - start - s.next -= diff - s.start -= diff - s.end -= diff -} - -// scan parses the next token of a BCP 47 string. Tokens that are larger -// than 8 characters or include non-alphanumeric characters result in an error -// and are gobbled and removed from the output. -// It returns the end position of the last token consumed. -func (s *scanner) scan() (end int) { - end = s.end - s.token = nil - for s.start = s.next; s.next < len(s.b); { - i := bytes.IndexByte(s.b[s.next:], '-') - if i == -1 { - s.end = len(s.b) - s.next = len(s.b) - i = s.end - s.start - } else { - s.end = s.next + i - s.next = s.end + 1 - } - token := s.b[s.start:s.end] - if i < 1 || i > 8 || !isAlphaNum(token) { - s.gobble(errSyntax) - continue - } - s.token = token - return end - } - if n := len(s.b); n > 0 && s.b[n-1] == '-' { - s.setError(errSyntax) - s.b = s.b[:len(s.b)-1] - } - s.done = true - return end -} - -// acceptMinSize parses multiple tokens of the given size or greater. -// It returns the end position of the last token consumed. -func (s *scanner) acceptMinSize(min int) (end int) { - end = s.end - s.scan() - for ; len(s.token) >= min; s.scan() { - end = s.end - } - return end -} - -// Parse parses the given BCP 47 string and returns a valid Tag. If parsing -// failed it returns an error and any part of the tag that could be parsed. -// If parsing succeeded but an unknown value was found, it returns -// ValueError. The Tag returned in this case is just stripped of the unknown -// value. All other values are preserved. It accepts tags in the BCP 47 format -// and extensions to this standard defined in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// The resulting tag is canonicalized using the default canonicalization type. -func Parse(s string) (t Tag, err error) { - return Default.Parse(s) -} - -// Parse parses the given BCP 47 string and returns a valid Tag. If parsing -// failed it returns an error and any part of the tag that could be parsed. -// If parsing succeeded but an unknown value was found, it returns -// ValueError. The Tag returned in this case is just stripped of the unknown -// value. All other values are preserved. It accepts tags in the BCP 47 format -// and extensions to this standard defined in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// The resulting tag is canonicalized using the the canonicalization type c. -func (c CanonType) Parse(s string) (t Tag, err error) { - // TODO: consider supporting old-style locale key-value pairs. - if s == "" { - return und, errSyntax - } - if len(s) <= maxAltTaglen { - b := [maxAltTaglen]byte{} - for i, c := range s { - // Generating invalid UTF-8 is okay as it won't match. - if 'A' <= c && c <= 'Z' { - c += 'a' - 'A' - } else if c == '_' { - c = '-' - } - b[i] = byte(c) - } - if t, ok := grandfathered(b); ok { - return t, nil - } - } - scan := makeScannerString(s) - t, err = parse(&scan, s) - t, changed := t.canonicalize(c) - if changed { - t.remakeString() - } - return t, err -} - -func parse(scan *scanner, s string) (t Tag, err error) { - t = und - var end int - if n := len(scan.token); n <= 1 { - scan.toLower(0, len(scan.b)) - if n == 0 || scan.token[0] != 'x' { - return t, errSyntax - } - end = parseExtensions(scan) - } else if n >= 4 { - return und, errSyntax - } else { // the usual case - t, end = parseTag(scan) - if n := len(scan.token); n == 1 { - t.pExt = uint16(end) - end = parseExtensions(scan) - } else if end < len(scan.b) { - scan.setError(errSyntax) - scan.b = scan.b[:end] - } - } - if int(t.pVariant) < len(scan.b) { - if end < len(s) { - s = s[:end] - } - if len(s) > 0 && tag.Compare(s, scan.b) == 0 { - t.str = s - } else { - t.str = string(scan.b) - } - } else { - t.pVariant, t.pExt = 0, 0 - } - return t, scan.err -} - -// parseTag parses language, script, region and variants. -// It returns a Tag and the end position in the input that was parsed. -func parseTag(scan *scanner) (t Tag, end int) { - var e error - // TODO: set an error if an unknown lang, script or region is encountered. - t.lang, e = getLangID(scan.token) - scan.setError(e) - scan.replace(t.lang.String()) - langStart := scan.start - end = scan.scan() - for len(scan.token) == 3 && isAlpha(scan.token[0]) { - // From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent - // to a tag of the form <extlang>. - lang, e := getLangID(scan.token) - if lang != 0 { - t.lang = lang - copy(scan.b[langStart:], lang.String()) - scan.b[langStart+3] = '-' - scan.start = langStart + 4 - } - scan.gobble(e) - end = scan.scan() - } - if len(scan.token) == 4 && isAlpha(scan.token[0]) { - t.script, e = getScriptID(script, scan.token) - if t.script == 0 { - scan.gobble(e) - } - end = scan.scan() - } - if n := len(scan.token); n >= 2 && n <= 3 { - t.region, e = getRegionID(scan.token) - if t.region == 0 { - scan.gobble(e) - } else { - scan.replace(t.region.String()) - } - end = scan.scan() - } - scan.toLower(scan.start, len(scan.b)) - t.pVariant = byte(end) - end = parseVariants(scan, end, t) - t.pExt = uint16(end) - return t, end -} - -var separator = []byte{'-'} - -// parseVariants scans tokens as long as each token is a valid variant string. -// Duplicate variants are removed. -func parseVariants(scan *scanner, end int, t Tag) int { - start := scan.start - varIDBuf := [4]uint8{} - variantBuf := [4][]byte{} - varID := varIDBuf[:0] - variant := variantBuf[:0] - last := -1 - needSort := false - for ; len(scan.token) >= 4; scan.scan() { - // TODO: measure the impact of needing this conversion and redesign - // the data structure if there is an issue. - v, ok := variantIndex[string(scan.token)] - if !ok { - // unknown variant - // TODO: allow user-defined variants? - scan.gobble(mkErrInvalid(scan.token)) - continue - } - varID = append(varID, v) - variant = append(variant, scan.token) - if !needSort { - if last < int(v) { - last = int(v) - } else { - needSort = true - // There is no legal combinations of more than 7 variants - // (and this is by no means a useful sequence). - const maxVariants = 8 - if len(varID) > maxVariants { - break - } - } - } - end = scan.end - } - if needSort { - sort.Sort(variantsSort{varID, variant}) - k, l := 0, -1 - for i, v := range varID { - w := int(v) - if l == w { - // Remove duplicates. - continue - } - varID[k] = varID[i] - variant[k] = variant[i] - k++ - l = w - } - if str := bytes.Join(variant[:k], separator); len(str) == 0 { - end = start - 1 - } else { - scan.resizeRange(start, end, len(str)) - copy(scan.b[scan.start:], str) - end = scan.end - } - } - return end -} - -type variantsSort struct { - i []uint8 - v [][]byte -} - -func (s variantsSort) Len() int { - return len(s.i) -} - -func (s variantsSort) Swap(i, j int) { - s.i[i], s.i[j] = s.i[j], s.i[i] - s.v[i], s.v[j] = s.v[j], s.v[i] -} - -func (s variantsSort) Less(i, j int) bool { - return s.i[i] < s.i[j] -} - -type bytesSort [][]byte - -func (b bytesSort) Len() int { - return len(b) -} - -func (b bytesSort) Swap(i, j int) { - b[i], b[j] = b[j], b[i] -} - -func (b bytesSort) Less(i, j int) bool { - return bytes.Compare(b[i], b[j]) == -1 -} - -// parseExtensions parses and normalizes the extensions in the buffer. -// It returns the last position of scan.b that is part of any extension. -// It also trims scan.b to remove excess parts accordingly. -func parseExtensions(scan *scanner) int { - start := scan.start - exts := [][]byte{} - private := []byte{} - end := scan.end - for len(scan.token) == 1 { - extStart := scan.start - ext := scan.token[0] - end = parseExtension(scan) - extension := scan.b[extStart:end] - if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { - scan.setError(errSyntax) - end = extStart - continue - } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { - scan.b = scan.b[:end] - return end - } else if ext == 'x' { - private = extension - break - } - exts = append(exts, extension) - } - sort.Sort(bytesSort(exts)) - if len(private) > 0 { - exts = append(exts, private) - } - scan.b = scan.b[:start] - if len(exts) > 0 { - scan.b = append(scan.b, bytes.Join(exts, separator)...) - } else if start > 0 { - // Strip trailing '-'. - scan.b = scan.b[:start-1] - } - return end -} - -// parseExtension parses a single extension and returns the position of -// the extension end. -func parseExtension(scan *scanner) int { - start, end := scan.start, scan.end - switch scan.token[0] { - case 'u': - attrStart := end - scan.scan() - for last := []byte{}; len(scan.token) > 2; scan.scan() { - if bytes.Compare(scan.token, last) != -1 { - // Attributes are unsorted. Start over from scratch. - p := attrStart + 1 - scan.next = p - attrs := [][]byte{} - for scan.scan(); len(scan.token) > 2; scan.scan() { - attrs = append(attrs, scan.token) - end = scan.end - } - sort.Sort(bytesSort(attrs)) - copy(scan.b[p:], bytes.Join(attrs, separator)) - break - } - last = scan.token - end = scan.end - } - var last, key []byte - for attrEnd := end; len(scan.token) == 2; last = key { - key = scan.token - keyEnd := scan.end - end = scan.acceptMinSize(3) - // TODO: check key value validity - if keyEnd == end || bytes.Compare(key, last) != 1 { - // We have an invalid key or the keys are not sorted. - // Start scanning keys from scratch and reorder. - p := attrEnd + 1 - scan.next = p - keys := [][]byte{} - for scan.scan(); len(scan.token) == 2; { - keyStart, keyEnd := scan.start, scan.end - end = scan.acceptMinSize(3) - if keyEnd != end { - keys = append(keys, scan.b[keyStart:end]) - } else { - scan.setError(errSyntax) - end = keyStart - } - } - sort.Sort(bytesSort(keys)) - reordered := bytes.Join(keys, separator) - if e := p + len(reordered); e < end { - scan.deleteRange(e, end) - end = e - } - copy(scan.b[p:], bytes.Join(keys, separator)) - break - } - } - case 't': - scan.scan() - if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { - _, end = parseTag(scan) - scan.toLower(start, end) - } - for len(scan.token) == 2 && !isAlpha(scan.token[1]) { - end = scan.acceptMinSize(3) - } - case 'x': - end = scan.acceptMinSize(1) - default: - end = scan.acceptMinSize(2) - } - return end -} - -// Compose creates a Tag from individual parts, which may be of type Tag, Base, -// Script, Region, Variant, []Variant, Extension, []Extension or error. If a -// Base, Script or Region or slice of type Variant or Extension is passed more -// than once, the latter will overwrite the former. Variants and Extensions are -// accumulated, but if two extensions of the same type are passed, the latter -// will replace the former. A Tag overwrites all former values and typically -// only makes sense as the first argument. The resulting tag is returned after -// canonicalizing using the Default CanonType. If one or more errors are -// encountered, one of the errors is returned. -func Compose(part ...interface{}) (t Tag, err error) { - return Default.Compose(part...) -} - -// Compose creates a Tag from individual parts, which may be of type Tag, Base, -// Script, Region, Variant, []Variant, Extension, []Extension or error. If a -// Base, Script or Region or slice of type Variant or Extension is passed more -// than once, the latter will overwrite the former. Variants and Extensions are -// accumulated, but if two extensions of the same type are passed, the latter -// will replace the former. A Tag overwrites all former values and typically -// only makes sense as the first argument. The resulting tag is returned after -// canonicalizing using CanonType c. If one or more errors are encountered, -// one of the errors is returned. -func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { - var b builder - if err = b.update(part...); err != nil { - return und, err - } - t, _ = b.tag.canonicalize(c) - - if len(b.ext) > 0 || len(b.variant) > 0 { - sort.Sort(sortVariant(b.variant)) - sort.Strings(b.ext) - if b.private != "" { - b.ext = append(b.ext, b.private) - } - n := maxCoreSize + tokenLen(b.variant...) + tokenLen(b.ext...) - buf := make([]byte, n) - p := t.genCoreBytes(buf) - t.pVariant = byte(p) - p += appendTokens(buf[p:], b.variant...) - t.pExt = uint16(p) - p += appendTokens(buf[p:], b.ext...) - t.str = string(buf[:p]) - } else if b.private != "" { - t.str = b.private - t.remakeString() - } - return -} - -type builder struct { - tag Tag - - private string // the x extension - ext []string - variant []string - - err error -} - -func (b *builder) addExt(e string) { - if e == "" { - } else if e[0] == 'x' { - b.private = e - } else { - b.ext = append(b.ext, e) - } -} - -var errInvalidArgument = errors.New("invalid Extension or Variant") - -func (b *builder) update(part ...interface{}) (err error) { - replace := func(l *[]string, s string, eq func(a, b string) bool) bool { - if s == "" { - b.err = errInvalidArgument - return true - } - for i, v := range *l { - if eq(v, s) { - (*l)[i] = s - return true - } - } - return false - } - for _, x := range part { - switch v := x.(type) { - case Tag: - b.tag.lang = v.lang - b.tag.region = v.region - b.tag.script = v.script - if v.str != "" { - b.variant = nil - for x, s := "", v.str[v.pVariant:v.pExt]; s != ""; { - x, s = nextToken(s) - b.variant = append(b.variant, x) - } - b.ext, b.private = nil, "" - for i, e := int(v.pExt), ""; i < len(v.str); { - i, e = getExtension(v.str, i) - b.addExt(e) - } - } - case Base: - b.tag.lang = v.langID - case Script: - b.tag.script = v.scriptID - case Region: - b.tag.region = v.regionID - case Variant: - if !replace(&b.variant, v.variant, func(a, b string) bool { return a == b }) { - b.variant = append(b.variant, v.variant) - } - case Extension: - if !replace(&b.ext, v.s, func(a, b string) bool { return a[0] == b[0] }) { - b.addExt(v.s) - } - case []Variant: - b.variant = nil - for _, x := range v { - b.update(x) - } - case []Extension: - b.ext, b.private = nil, "" - for _, e := range v { - b.update(e) - } - // TODO: support parsing of raw strings based on morphology or just extensions? - case error: - err = v - } - } - return -} - -func tokenLen(token ...string) (n int) { - for _, t := range token { - n += len(t) + 1 - } - return -} - -func appendTokens(b []byte, token ...string) int { - p := 0 - for _, t := range token { - b[p] = '-' - copy(b[p+1:], t) - p += 1 + len(t) - } - return p -} - -type sortVariant []string - -func (s sortVariant) Len() int { - return len(s) -} - -func (s sortVariant) Swap(i, j int) { - s[j], s[i] = s[i], s[j] -} - -func (s sortVariant) Less(i, j int) bool { - return variantIndex[s[i]] < variantIndex[s[j]] -} - -func findExt(list []string, x byte) int { - for i, e := range list { - if e[0] == x { - return i - } - } - return -1 -} - -// getExtension returns the name, body and end position of the extension. -func getExtension(s string, p int) (end int, ext string) { - if s[p] == '-' { - p++ - } - if s[p] == 'x' { - return len(s), s[p:] - } - end = nextExtension(s, p) - return end, s[p:end] -} - -// nextExtension finds the next extension within the string, searching -// for the -<char>- pattern from position p. -// In the fast majority of cases, language tags will have at most -// one extension and extensions tend to be small. -func nextExtension(s string, p int) int { - for n := len(s) - 3; p < n; { - if s[p] == '-' { - if s[p+2] == '-' { - return p - } - p += 3 - } else { - p++ - } - } - return len(s) -} - -var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") - -// ParseAcceptLanguage parses the contents of an Accept-Language header as -// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and -// a list of corresponding quality weights. It is more permissive than RFC 2616 -// and may return non-nil slices even if the input is not valid. -// The Tags will be sorted by highest weight first and then by first occurrence. -// Tags with a weight of zero will be dropped. An error will be returned if the -// input could not be parsed. -func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { - var entry string - for s != "" { - if entry, s = split(s, ','); entry == "" { - continue - } - - entry, weight := split(entry, ';') - - // Scan the language. - t, err := Parse(entry) - if err != nil { - id, ok := acceptFallback[entry] - if !ok { - return nil, nil, err - } - t = Tag{lang: id} - } - - // Scan the optional weight. - w := 1.0 - if weight != "" { - weight = consume(weight, 'q') - weight = consume(weight, '=') - // consume returns the empty string when a token could not be - // consumed, resulting in an error for ParseFloat. - if w, err = strconv.ParseFloat(weight, 32); err != nil { - return nil, nil, errInvalidWeight - } - // Drop tags with a quality weight of 0. - if w <= 0 { - continue - } - } - - tag = append(tag, t) - q = append(q, float32(w)) - } - sortStable(&tagSort{tag, q}) - return tag, q, nil -} - -// consume removes a leading token c from s and returns the result or the empty -// string if there is no such token. -func consume(s string, c byte) string { - if s == "" || s[0] != c { - return "" - } - return strings.TrimSpace(s[1:]) -} - -func split(s string, c byte) (head, tail string) { - if i := strings.IndexByte(s, c); i >= 0 { - return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:]) - } - return strings.TrimSpace(s), "" -} - -// Add hack mapping to deal with a small number of cases that that occur -// in Accept-Language (with reasonable frequency). -var acceptFallback = map[string]langID{ - "english": _en, - "deutsch": _de, - "italian": _it, - "french": _fr, - "*": _mul, // defined in the spec to match all languages. -} - -type tagSort struct { - tag []Tag - q []float32 -} - -func (s *tagSort) Len() int { - return len(s.q) -} - -func (s *tagSort) Less(i, j int) bool { - return s.q[i] > s.q[j] -} - -func (s *tagSort) Swap(i, j int) { - s.tag[i], s.tag[j] = s.tag[j], s.tag[i] - s.q[i], s.q[j] = s.q[j], s.q[i] -} diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go deleted file mode 100644 index ec17f97..0000000 --- a/vendor/golang.org/x/text/language/tables.go +++ /dev/null @@ -1,3675 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -import "golang.org/x/text/internal/tag" - -// CLDRVersion is the CLDR version from which the tables in this package are derived. -const CLDRVersion = "31" - -const numLanguages = 8665 - -const numScripts = 237 - -const numRegions = 357 - -type fromTo struct { - from uint16 - to uint16 -} - -const nonCanonicalUnd = 1199 -const ( - _af = 22 - _am = 39 - _ar = 58 - _az = 88 - _bg = 126 - _bn = 165 - _ca = 215 - _cs = 249 - _da = 256 - _de = 268 - _el = 309 - _en = 312 - _es = 317 - _et = 319 - _fa = 327 - _fi = 336 - _fil = 338 - _fr = 349 - _gu = 418 - _he = 442 - _hi = 444 - _hr = 463 - _hu = 467 - _hy = 469 - _id = 479 - _is = 502 - _it = 503 - _ja = 510 - _ka = 526 - _kk = 576 - _km = 584 - _kn = 591 - _ko = 594 - _ky = 648 - _lo = 694 - _lt = 702 - _lv = 709 - _mk = 765 - _ml = 770 - _mn = 777 - _mo = 782 - _mr = 793 - _ms = 797 - _mul = 804 - _my = 815 - _nb = 837 - _ne = 847 - _nl = 869 - _no = 877 - _pa = 923 - _pl = 945 - _pt = 958 - _ro = 986 - _ru = 992 - _sh = 1029 - _si = 1034 - _sk = 1040 - _sl = 1044 - _sq = 1071 - _sr = 1072 - _sv = 1090 - _sw = 1091 - _ta = 1102 - _te = 1119 - _th = 1129 - _tl = 1144 - _tn = 1150 - _tr = 1160 - _uk = 1196 - _ur = 1202 - _uz = 1210 - _vi = 1217 - _zh = 1319 - _zu = 1324 - _jbo = 513 - _ami = 1647 - _bnn = 2354 - _hak = 436 - _tlh = 14464 - _lb = 659 - _nv = 897 - _pwn = 12052 - _tao = 14185 - _tay = 14195 - _tsu = 14659 - _nn = 872 - _sfb = 13626 - _vgt = 15698 - _sgg = 13657 - _cmn = 3004 - _nan = 833 - _hsn = 465 -) - -const langPrivateStart = 0x2f6f - -const langPrivateEnd = 0x3176 - -// lang holds an alphabetically sorted list of ISO-639 language identifiers. -// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. -// For 2-byte language identifiers, the two successive bytes have the following meaning: -// - if the first letter of the 2- and 3-letter ISO codes are the same: -// the second and third letter of the 3-letter ISO code. -// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. -// For 3-byte language identifiers the 4th byte is 0. -const lang tag.Index = "" + // Size: 5312 bytes - "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + - "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + - "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + - "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + - "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + - "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + - "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + - "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + - "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + - "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + - "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + - "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + - "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + - "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + - "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + - "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + - "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + - "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + - "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + - "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + - "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + - "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + - "kl\x00cko\x00cky\x00cla\x00cme\x00cooscop\x00cps\x00crrecrh\x00crj\x00cr" + - "k\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymdaandad" + - "\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00ddn" + - "\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia\x00d" + - "je\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm\x00dtp" + - "\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00dyo\x00d" + - "yu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00elllema" + - "\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr\x00ett" + - "\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai\x00fan" + - "\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00foaofod" + - "\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00fub\x00f" + - "ud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyrygalega" + - "a\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gbf\x00gbm" + - "\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00gej\x00gel\x00g" + - "ez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju\x00gkn\x00gkp" + - "\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof\x00goi\x00gom" + - "\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw\x00gsw\x00guujg" + - "ub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf\x00gvr\x00gvs" + - "\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00haw\x00haz\x00h" + - "bb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hil\x00hla\x00hl" + - "u\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homohoc\x00hoj\x00" + - "hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian\x00iar\x00iba" + - "\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00ieleife\x00igbo" + - "igb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00ilo\x00imo\x00i" + - "nndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00iws\x00izh\x00i" + - "zi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo\x00ji\x00\x06jib" + - "\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab\x00kac\x00kad\x00" + - "kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq\x00kbx\x00kby\x00kc" + - "g\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt\x00kea\x00ken\x00kez" + - "\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00kha\x00khb\x00khn\x00k" + - "hq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu\x00kiw\x00kjuakjd\x00kj" + - "g\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00klq\x00klt\x00klx\x00kmh" + - "mkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knanknf\x00knp\x00koorkoi\x00" + - "kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo\x00kpr\x00kpx\x00kqb\x00kq" + - "f\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00krl\x00krs\x00kru\x00ksasksb" + - "\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb\x00ktm\x00kto\x00kuurkub\x00k" + - "ud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00kus\x00kvomkvg\x00kvr\x00kvx" + - "\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm\x00kxp\x00kxw\x00kxz\x00ky" + - "irkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag\x00lah\x00laj\x00las\x00lbt" + - "zlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00led\x00lee\x00lem\x00lep\x00l" + - "eq\x00leu\x00lez\x00lguglgg\x00liimlia\x00lid\x00lif\x00lig\x00lih\x00li" + - "j\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln\x00lmn\x00lmo\x00lmp\x00lnin" + - "lns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor\x00los\x00loz\x00lrc\x00ltitl" + - "tg\x00luublua\x00luo\x00luy\x00luz\x00lvavlwl\x00lzh\x00lzz\x00mad\x00ma" + - "f\x00mag\x00mai\x00mak\x00man\x00mas\x00maw\x00maz\x00mbh\x00mbo\x00mbq" + - "\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr\x00mcu\x00mda\x00mde\x00mdf" + - "\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee\x00mek\x00men\x00mer\x00met" + - "\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq\x00mglgmgh\x00mgl\x00mgo\x00m" + - "gp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00min\x00mis\x00miw\x00mkkdmki" + - "\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00mls\x00mmo\x00mmu\x00mmx\x00m" + - "nonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00moe\x00moh\x00mos\x00mox\x00mp" + - "p\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00mrj\x00mro\x00mssamtltmtc" + - "\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00mus\x00mva\x00mvn\x00mvy" + - "\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk\x00mym\x00myv\x00myw\x00m" + - "yx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw\x00mzz\x00naaunac\x00naf" + - "\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00nbobnca\x00nce\x00ncf\x00n" + - "ch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb\x00new\x00nex\x00nfr\x00ng" + - "donga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00nif\x00nii\x00nij\x00nin\x00" + - "niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nlldnmg\x00nmz\x00nnnonnf\x00n" + - "nh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00nop\x00nou\x00nqo\x00nrblnr" + - "b\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr\x00nui\x00nup\x00nus\x00nuv" + - "\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym\x00nyn\x00nzi\x00occiogc\x00" + - "ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00opm\x00orrioro\x00oru\x00osss" + - "osa\x00ota\x00otk\x00ozm\x00paanpag\x00pal\x00pam\x00pap\x00pau\x00pbi" + - "\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo\x00pex\x00pfl\x00phl\x00phn" + - "\x00pilipil\x00pip\x00pka\x00pko\x00plolpla\x00pms\x00png\x00pnn\x00pnt" + - "\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psuspss\x00ptorptp\x00puu\x00pwa" + - "\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rcf\x00rej\x00rel\x00res\x00r" + - "gn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmohrmf\x00rmo\x00rmt\x00rmu" + - "\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00rro\x00rtm\x00ruusrue\x00" + - "rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf\x00sah\x00saq\x00sas\x00sa" + - "t\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrdsck\x00scl\x00scn\x00sco\x00" + - "scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00sei\x00ses\x00sgagsga\x00sgs" + - "\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn\x00shu\x00siinsid\x00sig" + - "\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks\x00sllvsld\x00sli\x00sll" + - "\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp\x00smq\x00sms\x00snnasnc" + - "\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq\x00sou\x00soy\x00spd\x00s" + - "pl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx\x00ssswssd\x00ssg\x00ssy" + - "\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00sur\x00sus\x00svweswwaswb" + - "\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00syl\x00syr\x00szl\x00taamt" + - "aj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf\x00tbg\x00tbo\x00tbw\x00tbz" + - "\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelted\x00tem\x00teo\x00tet\x00t" + - "fi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00thq\x00thr\x00tiirtif\x00tig" + - "\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr\x00tkt\x00tlgltlf\x00tlx" + - "\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00tog\x00toq\x00tpi\x00tpm" + - "\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssotsd\x00tsf\x00tsg\x00tsj" + - "\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts\x00ttt\x00tuh\x00tul\x00t" + - "um\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00twq\x00txg\x00tyahtya\x00ty" + - "v\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli\x00umb\x00und\x00unr\x00unx" + - "\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00uvh\x00uvl\x00uzzbvag\x00vai" + - "\x00van\x00veenvec\x00vep\x00viievic\x00viv\x00vls\x00vmf\x00vmw\x00vool" + - "vot\x00vro\x00vun\x00vut\x00walnwae\x00waj\x00wal\x00wan\x00war\x00wbp" + - "\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg\x00wib\x00wiu\x00wiv\x00wja" + - "\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu\x00woolwob\x00wos\x00wrs\x00w" + - "sk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00xbi\x00xcr\x00xes\x00xhhoxla" + - "\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna\x00xnr\x00xog\x00xon\x00xpr" + - "\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe\x00yam\x00yao\x00yap\x00yas" + - "\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb\x00yby\x00yer\x00ygr\x00ygw" + - "\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00yooryon\x00yrb\x00yre\x00yrl" + - "\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw\x00zahazag\x00zbl\x00zdj\x00z" + - "ea\x00zgh\x00zhhozia\x00zlm\x00zmi\x00zne\x00zuulzxx\x00zza\x00\xff\xff" + - "\xff\xff" - -const langNoIndexOffset = 1327 - -// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index -// in lookup tables. The language ids for these language codes are derived directly -// from the letters and are not consecutive. -// Size: 2197 bytes, 2197 elements -var langNoIndex = [2197]uint8{ - // Entry 0 - 3F - 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, - 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, - 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, - 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, - 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, - 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, - 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, - // Entry 40 - 7F - 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, - 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, - 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, - 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, - 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, - 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, - 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, - 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, - // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, - 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, - 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, - 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, - 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, - 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, - 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, - 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, - // Entry C0 - FF - 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, - 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56, - 0x45, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef, - 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, - 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35, - 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, - // Entry 100 - 13F - 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, - 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, - 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, - 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, - 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f, - 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, - 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, - // Entry 140 - 17F - 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16, - 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, - 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09, - 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, - 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, - 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, - 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, - // Entry 180 - 1BF - 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, - 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, - 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, - 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, - 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7e, 0xbf, - // Entry 200 - 23F - 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, - 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, - 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf, - 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3, - 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, - 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, - 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, - // Entry 240 - 27F - 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, - 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0, - 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, - 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, - 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, - 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, - 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66, - // Entry 280 - 2BF - 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, - 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, - 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, - 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, - 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, - 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, - 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, - // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, - 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, - 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, - 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, - 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, - 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, - // Entry 300 - 33F - 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, - 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, - 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, - 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, - 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, - 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, - 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, - // Entry 340 - 37F - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, - 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, - 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, - 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, - 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, - 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, - 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, - 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, - // Entry 380 - 3BF - 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, - 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, - 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, - 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, - 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, - 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, - 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, - // Entry 3C0 - 3FF - 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, - 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01, - 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10, - 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, - 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, - // Entry 400 - 43F - 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, - 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, - 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, - 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, - 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, - 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, - 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, - 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, - // Entry 440 - 47F - 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, - 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, - 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, - 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, - 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, - 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd, - 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, - 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, - // Entry 480 - 4BF - 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb, - 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05, - 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, - 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, - // Entry 4C0 - 4FF - 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, - 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, - 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, - 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, - 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, - 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, - 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, - // Entry 500 - 53F - 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, - 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, - 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7, - 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, - 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, - 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, - 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, - // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - // Entry 580 - 5BF - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, - 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, - 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, - 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, - 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, - 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, - // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, - 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, - 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, - 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, - 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, - 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, - 0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe, - // Entry 600 - 63F - 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, - 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, - 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, - 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, - 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, - 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, - 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, - 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, - // Entry 640 - 67F - 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c, - 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, - 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98, - 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, - 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4, - 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, - 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, - // Entry 680 - 6BF - 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda, - 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, - 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, - 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, - 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, - 0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f, - // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, - 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41, - 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, - 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, - 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, - // Entry 700 - 73F - 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, - 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, - 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, - 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 740 - 77F - 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, - 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, - 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, - 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55, - 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, - 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, - // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, - 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, - 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, - 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, - 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, - // Entry 7C0 - 7FF - 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42, - 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56, - 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, - 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, - 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, - 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, - 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, - // Entry 800 - 83F - 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, - 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, - 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, - 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, - 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, - 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, - 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, - // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, - 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, - 0x84, 0x00, 0x23, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, - 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, - 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, - 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, - // Entry 880 - 8BF - 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, - 0x0a, 0x00, 0x80, 0x00, 0x00, -} - -// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives -// to 2-letter language codes that cannot be derived using the method described above. -// Each 3-letter code is followed by its 1-byte langID. -const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" - -// altLangIndex is used to convert indexes in altLangISO3 to langIDs. -// Size: 12 bytes, 6 elements -var altLangIndex = [6]uint16{ - 0x027f, 0x0405, 0x01f9, 0x03e3, 0x013d, 0x0206, -} - -// langAliasMap maps langIDs to their suggested replacements. -// Size: 656 bytes, 164 elements -var langAliasMap = [164]fromTo{ - 0: {from: 0x82, to: 0x88}, - 1: {from: 0x185, to: 0x1ac}, - 2: {from: 0x1f1, to: 0x1df}, - 3: {from: 0x1f9, to: 0x1ba}, - 4: {from: 0x206, to: 0x510}, - 5: {from: 0x20d, to: 0x20c}, - 6: {from: 0x30e, to: 0x3da}, - 7: {from: 0x345, to: 0x36d}, - 8: {from: 0x405, to: 0x430}, - 9: {from: 0x478, to: 0x152}, - 10: {from: 0x48e, to: 0x44f}, - 11: {from: 0x4a0, to: 0x21}, - 12: {from: 0x53b, to: 0x541}, - 13: {from: 0x58c, to: 0x12c}, - 14: {from: 0x62d, to: 0x1eae}, - 15: {from: 0x64e, to: 0x42f}, - 16: {from: 0x65f, to: 0x42f}, - 17: {from: 0x6ea, to: 0x3a}, - 18: {from: 0x6f5, to: 0x1d5}, - 19: {from: 0x73b, to: 0x219e}, - 20: {from: 0x7b0, to: 0x56}, - 21: {from: 0x7b6, to: 0x2998}, - 22: {from: 0x7c2, to: 0x58}, - 23: {from: 0x7e3, to: 0x144}, - 24: {from: 0x809, to: 0x5a}, - 25: {from: 0x812, to: 0x8d}, - 26: {from: 0x87b, to: 0x80d}, - 27: {from: 0x8c0, to: 0xee0}, - 28: {from: 0x9ec, to: 0x32f}, - 29: {from: 0xa33, to: 0x2c3}, - 30: {from: 0xa3a, to: 0xbf}, - 31: {from: 0xabb, to: 0x331f}, - 32: {from: 0xb35, to: 0x527}, - 33: {from: 0xb72, to: 0x2657}, - 34: {from: 0xb7b, to: 0xbc0}, - 35: {from: 0xb98, to: 0x44c}, - 36: {from: 0xbb9, to: 0x4226}, - 37: {from: 0xbbc, to: 0x527}, - 38: {from: 0xbfb, to: 0x2da4}, - 39: {from: 0xc2b, to: 0x317e}, - 40: {from: 0xcb6, to: 0xf2}, - 41: {from: 0xd05, to: 0xf9}, - 42: {from: 0xdc5, to: 0x119}, - 43: {from: 0xdd4, to: 0x32b}, - 44: {from: 0xdf5, to: 0xdf8}, - 45: {from: 0xdfb, to: 0x52e}, - 46: {from: 0xedc, to: 0x2057}, - 47: {from: 0xeeb, to: 0x2e97}, - 48: {from: 0xf36, to: 0x365}, - 49: {from: 0x10cd, to: 0x13f}, - 50: {from: 0x1101, to: 0x2ce}, - 51: {from: 0x119d, to: 0x1ea}, - 52: {from: 0x1276, to: 0x21}, - 53: {from: 0x1421, to: 0x15d}, - 54: {from: 0x146d, to: 0x14d}, - 55: {from: 0x151c, to: 0xd98}, - 56: {from: 0x1520, to: 0x38e}, - 57: {from: 0x152f, to: 0x19d}, - 58: {from: 0x157d, to: 0x20e}, - 59: {from: 0x1580, to: 0x10c}, - 60: {from: 0x15a0, to: 0x3cac}, - 61: {from: 0x1667, to: 0x199}, - 62: {from: 0x16c5, to: 0x135}, - 63: {from: 0x16fd, to: 0x29f5}, - 64: {from: 0x1715, to: 0x192}, - 65: {from: 0x1724, to: 0xf3c}, - 66: {from: 0x1777, to: 0x1521}, - 67: {from: 0x1806, to: 0x17b3}, - 68: {from: 0x1813, to: 0x18f0}, - 69: {from: 0x1887, to: 0x434}, - 70: {from: 0x1976, to: 0x1cfe}, - 71: {from: 0x1a71, to: 0x2bad}, - 72: {from: 0x1a87, to: 0x1f6}, - 73: {from: 0x1b57, to: 0x1f8}, - 74: {from: 0x1b83, to: 0x1512}, - 75: {from: 0x1d61, to: 0x2c98}, - 76: {from: 0x2035, to: 0x37ae}, - 77: {from: 0x203a, to: 0x20da}, - 78: {from: 0x2057, to: 0x309}, - 79: {from: 0x20e0, to: 0x272}, - 80: {from: 0x20eb, to: 0x261}, - 81: {from: 0x20ef, to: 0x22b}, - 82: {from: 0x20f6, to: 0x254}, - 83: {from: 0x210c, to: 0x21e8}, - 84: {from: 0x2132, to: 0x27b}, - 85: {from: 0x215d, to: 0x910}, - 86: {from: 0x2196, to: 0x120}, - 87: {from: 0x21cb, to: 0x155e}, - 88: {from: 0x21e3, to: 0x502}, - 89: {from: 0x21f1, to: 0x49d}, - 90: {from: 0x222a, to: 0x120}, - 91: {from: 0x2234, to: 0x120}, - 92: {from: 0x225f, to: 0x927}, - 93: {from: 0x2313, to: 0x3223}, - 94: {from: 0x237f, to: 0x3362}, - 95: {from: 0x246f, to: 0x2c5}, - 96: {from: 0x24e1, to: 0x2fd}, - 97: {from: 0x24ed, to: 0x2f8}, - 98: {from: 0x24f7, to: 0x31d}, - 99: {from: 0x254d, to: 0xb58}, - 100: {from: 0x25a6, to: 0xe2}, - 101: {from: 0x263b, to: 0x2ce}, - 102: {from: 0x26c6, to: 0x26b1}, - 103: {from: 0x26f6, to: 0x3c6}, - 104: {from: 0x2724, to: 0x3cac}, - 105: {from: 0x2762, to: 0x26b1}, - 106: {from: 0x2786, to: 0x4355}, - 107: {from: 0x28ec, to: 0x2834}, - 108: {from: 0x2911, to: 0x34f}, - 109: {from: 0x2983, to: 0x2da4}, - 110: {from: 0x2b17, to: 0x38b}, - 111: {from: 0x2bf9, to: 0x393}, - 112: {from: 0x2c3c, to: 0x3cac}, - 113: {from: 0x2cf9, to: 0x3bc}, - 114: {from: 0x2d10, to: 0x594}, - 115: {from: 0x2d44, to: 0x147}, - 116: {from: 0x2d45, to: 0x147}, - 117: {from: 0x2dfc, to: 0x2ef}, - 118: {from: 0x2e05, to: 0x19c9}, - 119: {from: 0x2e17, to: 0x2d92}, - 120: {from: 0x2e1e, to: 0x290}, - 121: {from: 0x2e51, to: 0x7d}, - 122: {from: 0x2e62, to: 0x227f}, - 123: {from: 0x2e9d, to: 0x2e98}, - 124: {from: 0x2eec, to: 0x2ed4}, - 125: {from: 0x3190, to: 0x3c2}, - 126: {from: 0x3363, to: 0x338b}, - 127: {from: 0x3427, to: 0x3da}, - 128: {from: 0x34eb, to: 0x18cd}, - 129: {from: 0x35c5, to: 0x2c98}, - 130: {from: 0x35e3, to: 0x410}, - 131: {from: 0x3655, to: 0x244}, - 132: {from: 0x3673, to: 0x3f2}, - 133: {from: 0x36fa, to: 0x443}, - 134: {from: 0x37bd, to: 0x120}, - 135: {from: 0x3813, to: 0x38ef}, - 136: {from: 0x3828, to: 0x2c98}, - 137: {from: 0x382c, to: 0xa9}, - 138: {from: 0x382f, to: 0x3225}, - 139: {from: 0x3869, to: 0x39a3}, - 140: {from: 0x388f, to: 0x3fbd}, - 141: {from: 0x38a2, to: 0x39d4}, - 142: {from: 0x38b1, to: 0x1fa1}, - 143: {from: 0x38b2, to: 0x2e97}, - 144: {from: 0x3959, to: 0x47c}, - 145: {from: 0x3b4b, to: 0xd8e}, - 146: {from: 0x3b75, to: 0x136}, - 147: {from: 0x3c96, to: 0x4ba}, - 148: {from: 0x3fba, to: 0xff}, - 149: {from: 0x4205, to: 0xa8e}, - 150: {from: 0x42bb, to: 0x570}, - 151: {from: 0x42f6, to: 0x3f5d}, - 152: {from: 0x4375, to: 0x258}, - 153: {from: 0x43c8, to: 0x36c8}, - 154: {from: 0x43ca, to: 0x10e}, - 155: {from: 0x44ac, to: 0x331f}, - 156: {from: 0x44e0, to: 0x510}, - 157: {from: 0x45c7, to: 0x2406}, - 158: {from: 0x45da, to: 0x26d9}, - 159: {from: 0x460d, to: 0x48ab}, - 160: {from: 0x46ab, to: 0x469d}, - 161: {from: 0x473b, to: 0x4742}, - 162: {from: 0x4913, to: 0x31d}, - 163: {from: 0x49a4, to: 0x521}, -} - -// Size: 164 bytes, 164 elements -var langAliasTypes = [164]langAliasType{ - // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0, - 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0, - 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, - // Entry 40 - 7F - 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1, - 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, - 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, - 0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, - // Entry 80 - BF - 0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, - 1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, - 0, 1, 1, 1, -} - -const ( - _Latn = 85 - _Hani = 53 - _Hans = 55 - _Hant = 56 - _Qaaa = 136 - _Qaai = 144 - _Qabx = 185 - _Zinh = 231 - _Zyyy = 236 - _Zzzz = 237 -) - -// script is an alphabetically sorted list of ISO 15924 codes. The index -// of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 956 bytes - "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + - "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCprtCyrlCyrsDevaDogrDsrtDupl" + - "EgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHangHani" + - "HanoHansHantHatrHebrHiraHluwHmngHrktHungIndsItalJamoJavaJpanJurcKaliKana" + - "KharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepcLimbLina" + - "LinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlymModiMong" + - "MoonMrooMteiMultMymrNarbNbatNewaNkgbNkooNshuOgamOlckOrkhOryaOsgeOsmaPalm" + - "PaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaaeQaafQaagQaah" + - "QaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaaz" + - "QabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabr" + - "QabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShawShrdSiddSind" + - "SinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTeng" + - "TfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWoleXpeoXsuxYiiiZanbZinhZmthZsye" + - "ZsymZxxxZyyyZzzz\xff\xff\xff\xff" - -// suppressScript is an index from langID to the dominant script for that language, -// if it exists. If a script is given, it should be suppressed from the language tag. -// Size: 1327 bytes, 1327 elements -var suppressScript = [1327]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x28, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 40 - 7F - 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x1e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, - // Entry 80 - BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry C0 - FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x55, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x55, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, - // Entry 100 - 13F - 0x55, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xda, - 0x00, 0x00, 0x00, 0x00, 0xdc, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x30, 0x00, 0x00, - 0x55, 0x00, 0x00, 0x55, 0x00, 0x55, 0x00, 0x55, - // Entry 140 - 17F - 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, 0x05, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x55, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, 0x55, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, - 0x55, 0x55, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x55, 0x55, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 180 - 1BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, - 0x00, 0x00, 0x55, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x55, 0x31, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x55, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x3a, 0x00, 0x20, 0x00, 0x00, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, - 0x55, 0x00, 0x55, 0x55, 0x00, 0x08, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x55, 0x00, 0x00, 0x00, 0x00, 0x55, 0x55, - 0x00, 0x3a, 0x00, 0x00, 0x00, 0x00, 0x44, 0x00, - // Entry 200 - 23F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 240 - 27F - 0x1e, 0x00, 0x00, 0x55, 0x00, 0x00, 0x00, 0x00, - 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x4d, - 0x00, 0x00, 0x4e, 0x00, 0x20, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 280 - 2BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, - // Entry 2C0 - 2FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, - // Entry 300 - 33F - 0x00, 0x00, 0x69, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x20, 0x00, 0x00, 0x00, 0x55, 0x55, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x70, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, 0x00, - // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, 0x55, 0x20, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, - 0x55, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x75, 0x55, 0x00, 0x00, 0x00, - 0x55, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, - 0x00, 0x00, 0x00, 0x7a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x32, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x55, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x55, 0x00, - // Entry 3C0 - 3FF - 0x00, 0x00, 0x55, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x55, 0x00, 0x00, 0x00, 0x00, 0x55, - 0x00, 0x00, 0x55, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x1e, 0x00, 0x00, 0x55, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 400 - 43F - 0x55, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc6, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x55, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, 0x00, - 0x00, 0x55, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, - 0x00, 0x55, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 440 - 47F - 0x00, 0x00, 0x55, 0x55, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xd3, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xd6, - 0x00, 0x55, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xdb, 0x00, 0x00, 0x00, 0x28, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, - 0x55, 0x00, 0x00, 0x00, 0x55, 0x00, 0x55, 0x00, - // Entry 480 - 4BF - 0x55, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, 0x00, - 0x55, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, - // Entry 4C0 - 4FF - 0x00, 0x55, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x55, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 500 - 53F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x3a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x55, 0x00, 0x00, -} - -const ( - _001 = 1 - _419 = 31 - _BR = 65 - _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 -) - -// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID -// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for -// the UN.M49 codes used for groups.) -const isoRegionOffset = 32 - -// regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 40 - 7F - 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 80 - BF - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, -} - -// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. -// Each 2-letter codes is followed by two bytes with the following meaning: -// - [A-Z}{2}: the first letter of the 2-letter code plus these two -// letters form the 3-letter ISO code. -// - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes - "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + - "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + - "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" - -// altRegionISO3 holds a list of 3-letter region codes that cannot be -// mapped to 2-letter codes using the default algorithm. This is a short list. -const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" - -// altRegionIDs holds a list of regionIDs the positions of which match those -// of the 3-letter ISO codes in altRegionISO3. -// Size: 22 bytes, 11 elements -var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, -} - -// Size: 80 bytes, 20 elements -var regionOldMap = [20]fromTo{ - 0: {from: 0x44, to: 0xc4}, - 1: {from: 0x58, to: 0xa7}, - 2: {from: 0x5f, to: 0x60}, - 3: {from: 0x66, to: 0x3b}, - 4: {from: 0x79, to: 0x78}, - 5: {from: 0x93, to: 0x37}, - 6: {from: 0xa3, to: 0x133}, - 7: {from: 0xc1, to: 0x133}, - 8: {from: 0xd7, to: 0x13f}, - 9: {from: 0xdc, to: 0x2b}, - 10: {from: 0xef, to: 0x133}, - 11: {from: 0xf2, to: 0xe2}, - 12: {from: 0xfc, to: 0x70}, - 13: {from: 0x103, to: 0x164}, - 14: {from: 0x12a, to: 0x126}, - 15: {from: 0x132, to: 0x7b}, - 16: {from: 0x13a, to: 0x13e}, - 17: {from: 0x141, to: 0x133}, - 18: {from: 0x15d, to: 0x15e}, - 19: {from: 0x163, to: 0x4b}, -} - -// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are -// codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ - // Entry 0 - 3F - 0, 1, 2, 3, 5, 9, 11, 13, - 14, 15, 17, 18, 19, 21, 29, 30, - 34, 35, 39, 53, 54, 57, 61, 142, - 143, 145, 150, 151, 154, 155, 202, 419, - 958, 0, 20, 784, 4, 28, 660, 8, - 51, 530, 24, 10, 32, 16, 40, 36, - 533, 248, 31, 70, 52, 50, 56, 854, - 100, 48, 108, 204, 652, 60, 96, 68, - // Entry 40 - 7F - 535, 76, 44, 64, 104, 74, 72, 112, - 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, - // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, - // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, - // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, - // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, -} - -// m49Index gives indexes into fromM49 based on the three most significant bits -// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in -// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] -// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. -// The region code is stored in the 9 lsb of the indexed value. -// Size: 18 bytes, 9 elements -var m49Index = [9]int16{ - 0, 59, 108, 143, 181, 220, 259, 291, - 333, -} - -// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. -// Size: 666 bytes, 333 elements -var fromM49 = [333]uint16{ - // Entry 0 - 3F - 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, - 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, - 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, - 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, - 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, - // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, - // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, - // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, - // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, - // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, -} - -// Size: 1615 bytes -var variantIndex = map[string]uint8{ - "1606nict": 0x0, - "1694acad": 0x1, - "1901": 0x2, - "1959acad": 0x3, - "1994": 0x4d, - "1996": 0x4, - "abl1943": 0x5, - "akuapem": 0x6, - "alalc97": 0x4f, - "aluku": 0x7, - "ao1990": 0x8, - "arevela": 0x9, - "arevmda": 0xa, - "asante": 0xb, - "baku1926": 0xc, - "balanka": 0xd, - "barla": 0xe, - "basiceng": 0xf, - "bauddha": 0x10, - "biscayan": 0x11, - "biske": 0x48, - "bohoric": 0x12, - "boont": 0x13, - "colb1945": 0x14, - "cornu": 0x15, - "dajnko": 0x16, - "ekavsk": 0x17, - "emodeng": 0x18, - "fonipa": 0x50, - "fonnapa": 0x51, - "fonupa": 0x52, - "fonxsamp": 0x53, - "hepburn": 0x19, - "heploc": 0x4e, - "hognorsk": 0x1a, - "hsistemo": 0x1b, - "ijekavsk": 0x1c, - "itihasa": 0x1d, - "jauer": 0x1e, - "jyutping": 0x1f, - "kkcor": 0x20, - "kociewie": 0x21, - "kscor": 0x22, - "laukika": 0x23, - "lipaw": 0x49, - "luna1918": 0x24, - "metelko": 0x25, - "monoton": 0x26, - "ndyuka": 0x27, - "nedis": 0x28, - "newfound": 0x29, - "njiva": 0x4a, - "nulik": 0x2a, - "osojs": 0x4b, - "oxendict": 0x2b, - "pahawh2": 0x2c, - "pahawh3": 0x2d, - "pahawh4": 0x2e, - "pamaka": 0x2f, - "petr1708": 0x30, - "pinyin": 0x31, - "polyton": 0x32, - "puter": 0x33, - "rigik": 0x34, - "rozaj": 0x35, - "rumgr": 0x36, - "scotland": 0x37, - "scouse": 0x38, - "simple": 0x54, - "solba": 0x4c, - "sotav": 0x39, - "spanglis": 0x3a, - "surmiran": 0x3b, - "sursilv": 0x3c, - "sutsilv": 0x3d, - "tarask": 0x3e, - "uccor": 0x3f, - "ucrcor": 0x40, - "ulster": 0x41, - "unifon": 0x42, - "vaidika": 0x43, - "valencia": 0x44, - "vallader": 0x45, - "wadegile": 0x46, - "xsistemo": 0x47, -} - -// variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 79 - -// nRegionGroups is the number of region groups. -const nRegionGroups = 33 - -type likelyLangRegion struct { - lang uint16 - region uint16 -} - -// likelyScript is a lookup table, indexed by scriptID, for the most likely -// languages and regions given a script. -// Size: 956 bytes, 239 elements -var likelyScript = [239]likelyLangRegion{ - 1: {lang: 0x14d, region: 0x84}, - 3: {lang: 0x2a0, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, - 8: {lang: 0x1d5, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, - 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, - 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e7, region: 0x99}, - 17: {lang: 0x527, region: 0x12e}, - 18: {lang: 0x3af, region: 0x99}, - 19: {lang: 0x15d, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, - 22: {lang: 0xdb, region: 0x35}, - 23: {lang: 0xf2, region: 0x49}, - 24: {lang: 0x4ee, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 28: {lang: 0xf0, region: 0x6b}, - 29: {lang: 0x19e, region: 0x5d}, - 30: {lang: 0x3e0, region: 0x106}, - 32: {lang: 0x1bc, region: 0x99}, - 35: {lang: 0x15d, region: 0x78}, - 38: {lang: 0x132, region: 0x6b}, - 39: {lang: 0x42f, region: 0x27}, - 40: {lang: 0x27, region: 0x6f}, - 42: {lang: 0x20e, region: 0x7d}, - 43: {lang: 0xfd, region: 0x38}, - 46: {lang: 0x19c, region: 0x130}, - 47: {lang: 0x3e7, region: 0x99}, - 48: {lang: 0x135, region: 0x87}, - 49: {lang: 0x1a2, region: 0x99}, - 50: {lang: 0x39b, region: 0x99}, - 51: {lang: 0x527, region: 0x12e}, - 52: {lang: 0x252, region: 0xab}, - 53: {lang: 0x527, region: 0x53}, - 54: {lang: 0x1c9, region: 0xe7}, - 55: {lang: 0x527, region: 0x53}, - 56: {lang: 0x527, region: 0x12e}, - 57: {lang: 0x2fb, region: 0x9b}, - 58: {lang: 0x1ba, region: 0x97}, - 59: {lang: 0x1fe, region: 0xa2}, - 60: {lang: 0x1c3, region: 0x12b}, - 61: {lang: 0x1c8, region: 0xaf}, - 63: {lang: 0x1d3, region: 0x92}, - 65: {lang: 0x141, region: 0x9e}, - 66: {lang: 0x252, region: 0xab}, - 67: {lang: 0x20c, region: 0x95}, - 68: {lang: 0x1fe, region: 0xa2}, - 70: {lang: 0x134, region: 0xc4}, - 71: {lang: 0x1fe, region: 0xa2}, - 72: {lang: 0x3b9, region: 0xe8}, - 73: {lang: 0x248, region: 0xa6}, - 74: {lang: 0x3f8, region: 0x99}, - 77: {lang: 0x24f, region: 0x99}, - 78: {lang: 0x252, region: 0xab}, - 80: {lang: 0x88, region: 0x99}, - 81: {lang: 0x36e, region: 0x123}, - 82: {lang: 0x2b6, region: 0xaf}, - 87: {lang: 0x29d, region: 0x99}, - 88: {lang: 0x2a6, region: 0x99}, - 89: {lang: 0x28d, region: 0x87}, - 90: {lang: 0x19e, region: 0x87}, - 91: {lang: 0x2aa, region: 0x53}, - 93: {lang: 0x4f2, region: 0x12b}, - 94: {lang: 0x4f3, region: 0x12b}, - 95: {lang: 0x1bc, region: 0x99}, - 97: {lang: 0x335, region: 0x9c}, - 98: {lang: 0x4f5, region: 0x53}, - 99: {lang: 0xa9, region: 0x53}, - 102: {lang: 0x2e6, region: 0x112}, - 103: {lang: 0x4f6, region: 0x10b}, - 104: {lang: 0x4f6, region: 0x10b}, - 105: {lang: 0x302, region: 0x99}, - 106: {lang: 0x319, region: 0x99}, - 107: {lang: 0x309, region: 0x53}, - 109: {lang: 0x31c, region: 0x35}, - 110: {lang: 0x30c, region: 0x99}, - 111: {lang: 0x412, region: 0xe8}, - 112: {lang: 0x32f, region: 0xc4}, - 113: {lang: 0x4f7, region: 0x108}, - 114: {lang: 0x3b, region: 0xa1}, - 115: {lang: 0x351, region: 0xdb}, - 117: {lang: 0x2ce, region: 0x84}, - 119: {lang: 0x401, region: 0x96}, - 120: {lang: 0x3ec, region: 0x99}, - 121: {lang: 0x399, region: 0xc5}, - 122: {lang: 0x393, region: 0x99}, - 123: {lang: 0x397, region: 0x135}, - 124: {lang: 0x427, region: 0x115}, - 125: {lang: 0x3b, region: 0x11c}, - 126: {lang: 0xfc, region: 0xc4}, - 127: {lang: 0x27b, region: 0x106}, - 128: {lang: 0x2c7, region: 0x53}, - 129: {lang: 0x39d, region: 0x9c}, - 130: {lang: 0x39d, region: 0x53}, - 132: {lang: 0x3ab, region: 0xb0}, - 134: {lang: 0x1c4, region: 0x53}, - 135: {lang: 0x4fb, region: 0x9c}, - 186: {lang: 0x3c9, region: 0x95}, - 188: {lang: 0x370, region: 0x10c}, - 189: {lang: 0x41e, region: 0x97}, - 191: {lang: 0x4fd, region: 0x15e}, - 192: {lang: 0x3ee, region: 0x99}, - 193: {lang: 0x45, region: 0x135}, - 194: {lang: 0x138, region: 0x7b}, - 195: {lang: 0x3e7, region: 0x99}, - 196: {lang: 0x3e7, region: 0x99}, - 197: {lang: 0x3f8, region: 0x99}, - 198: {lang: 0x40a, region: 0xb3}, - 199: {lang: 0x431, region: 0x99}, - 201: {lang: 0x43c, region: 0x95}, - 202: {lang: 0x44b, region: 0x35}, - 203: {lang: 0x44c, region: 0x9b}, - 207: {lang: 0x458, region: 0xe7}, - 208: {lang: 0x119, region: 0x99}, - 209: {lang: 0x45c, region: 0x53}, - 210: {lang: 0x230, region: 0x53}, - 211: {lang: 0x44e, region: 0x99}, - 212: {lang: 0x4a3, region: 0x53}, - 213: {lang: 0x9f, region: 0x13e}, - 214: {lang: 0x45f, region: 0x99}, - 216: {lang: 0x526, region: 0xba}, - 217: {lang: 0x152, region: 0xe7}, - 218: {lang: 0x127, region: 0xcd}, - 219: {lang: 0x469, region: 0x123}, - 220: {lang: 0xa9, region: 0x53}, - 221: {lang: 0x2cc, region: 0x99}, - 222: {lang: 0x4ab, region: 0x11c}, - 223: {lang: 0x4bc, region: 0xb4}, - 225: {lang: 0x1cc, region: 0x99}, - 227: {lang: 0x3a7, region: 0x9c}, - 228: {lang: 0x22, region: 0x9b}, - 229: {lang: 0x1e8, region: 0x53}, -} - -type likelyScriptRegion struct { - region uint16 - script uint8 - flags uint8 -} - -// likelyLang is a lookup table, indexed by langID, for the most likely -// scripts and regions given incomplete information. If more entries exist for a -// given language, region and script are the index and size respectively -// of the list in likelyLangList. -// Size: 5308 bytes, 1327 elements -var likelyLang = [1327]likelyScriptRegion{ - 0: {region: 0x135, script: 0x55, flags: 0x0}, - 1: {region: 0x6f, script: 0x55, flags: 0x0}, - 2: {region: 0x165, script: 0x55, flags: 0x0}, - 3: {region: 0x165, script: 0x55, flags: 0x0}, - 4: {region: 0x165, script: 0x55, flags: 0x0}, - 5: {region: 0x7d, script: 0x1e, flags: 0x0}, - 6: {region: 0x165, script: 0x55, flags: 0x0}, - 7: {region: 0x165, script: 0x1e, flags: 0x0}, - 8: {region: 0x80, script: 0x55, flags: 0x0}, - 9: {region: 0x165, script: 0x55, flags: 0x0}, - 10: {region: 0x165, script: 0x55, flags: 0x0}, - 11: {region: 0x165, script: 0x55, flags: 0x0}, - 12: {region: 0x95, script: 0x55, flags: 0x0}, - 13: {region: 0x131, script: 0x55, flags: 0x0}, - 14: {region: 0x80, script: 0x55, flags: 0x0}, - 15: {region: 0x165, script: 0x55, flags: 0x0}, - 16: {region: 0x165, script: 0x55, flags: 0x0}, - 17: {region: 0x106, script: 0x1e, flags: 0x0}, - 18: {region: 0x165, script: 0x55, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x55, flags: 0x0}, - 22: {region: 0x161, script: 0x55, flags: 0x0}, - 23: {region: 0x165, script: 0x55, flags: 0x0}, - 24: {region: 0x165, script: 0x55, flags: 0x0}, - 25: {region: 0x165, script: 0x55, flags: 0x0}, - 26: {region: 0x165, script: 0x55, flags: 0x0}, - 27: {region: 0x165, script: 0x55, flags: 0x0}, - 28: {region: 0x52, script: 0x55, flags: 0x0}, - 29: {region: 0x165, script: 0x55, flags: 0x0}, - 30: {region: 0x165, script: 0x55, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x55, flags: 0x0}, - 33: {region: 0x80, script: 0x55, flags: 0x0}, - 34: {region: 0x9b, script: 0xe4, flags: 0x0}, - 35: {region: 0x165, script: 0x55, flags: 0x0}, - 36: {region: 0x165, script: 0x55, flags: 0x0}, - 37: {region: 0x14d, script: 0x55, flags: 0x0}, - 38: {region: 0x106, script: 0x1e, flags: 0x0}, - 39: {region: 0x6f, script: 0x28, flags: 0x0}, - 40: {region: 0x165, script: 0x55, flags: 0x0}, - 41: {region: 0x165, script: 0x55, flags: 0x0}, - 42: {region: 0xd6, script: 0x55, flags: 0x0}, - 43: {region: 0x165, script: 0x55, flags: 0x0}, - 45: {region: 0x165, script: 0x55, flags: 0x0}, - 46: {region: 0x165, script: 0x55, flags: 0x0}, - 47: {region: 0x165, script: 0x55, flags: 0x0}, - 48: {region: 0x165, script: 0x55, flags: 0x0}, - 49: {region: 0x165, script: 0x55, flags: 0x0}, - 50: {region: 0x165, script: 0x55, flags: 0x0}, - 51: {region: 0x95, script: 0x55, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x55, flags: 0x0}, - 55: {region: 0x165, script: 0x55, flags: 0x0}, - 56: {region: 0x165, script: 0x55, flags: 0x0}, - 57: {region: 0x165, script: 0x55, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, - 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x55, flags: 0x0}, - 61: {region: 0x51, script: 0x55, flags: 0x0}, - 62: {region: 0x3f, script: 0x55, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x55, flags: 0x0}, - 69: {region: 0x135, script: 0xc1, flags: 0x0}, - 70: {region: 0x165, script: 0x55, flags: 0x0}, - 71: {region: 0x165, script: 0x55, flags: 0x0}, - 72: {region: 0x6e, script: 0x55, flags: 0x0}, - 73: {region: 0x165, script: 0x55, flags: 0x0}, - 74: {region: 0x165, script: 0x55, flags: 0x0}, - 75: {region: 0x49, script: 0x55, flags: 0x0}, - 76: {region: 0x165, script: 0x55, flags: 0x0}, - 77: {region: 0x106, script: 0x1e, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x55, flags: 0x0}, - 80: {region: 0x165, script: 0x55, flags: 0x0}, - 81: {region: 0x165, script: 0x55, flags: 0x0}, - 82: {region: 0x99, script: 0x20, flags: 0x0}, - 83: {region: 0x165, script: 0x55, flags: 0x0}, - 84: {region: 0x165, script: 0x55, flags: 0x0}, - 85: {region: 0x165, script: 0x55, flags: 0x0}, - 86: {region: 0x3f, script: 0x55, flags: 0x0}, - 87: {region: 0x165, script: 0x55, flags: 0x0}, - 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x1e, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x55, flags: 0x0}, - 92: {region: 0xdb, script: 0x20, flags: 0x0}, - 93: {region: 0x2e, script: 0x55, flags: 0x0}, - 94: {region: 0x52, script: 0x55, flags: 0x0}, - 95: {region: 0x165, script: 0x55, flags: 0x0}, - 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x55, flags: 0x0}, - 98: {region: 0x165, script: 0x55, flags: 0x0}, - 99: {region: 0x95, script: 0x55, flags: 0x0}, - 100: {region: 0x165, script: 0x55, flags: 0x0}, - 101: {region: 0x52, script: 0x55, flags: 0x0}, - 102: {region: 0x165, script: 0x55, flags: 0x0}, - 103: {region: 0x165, script: 0x55, flags: 0x0}, - 104: {region: 0x165, script: 0x55, flags: 0x0}, - 105: {region: 0x165, script: 0x55, flags: 0x0}, - 106: {region: 0x4f, script: 0x55, flags: 0x0}, - 107: {region: 0x165, script: 0x55, flags: 0x0}, - 108: {region: 0x165, script: 0x55, flags: 0x0}, - 109: {region: 0x165, script: 0x55, flags: 0x0}, - 110: {region: 0x165, script: 0x28, flags: 0x0}, - 111: {region: 0x165, script: 0x55, flags: 0x0}, - 112: {region: 0x165, script: 0x55, flags: 0x0}, - 113: {region: 0x47, script: 0x1e, flags: 0x0}, - 114: {region: 0x165, script: 0x55, flags: 0x0}, - 115: {region: 0x165, script: 0x55, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x55, flags: 0x0}, - 118: {region: 0x165, script: 0x55, flags: 0x0}, - 119: {region: 0x95, script: 0x55, flags: 0x0}, - 120: {region: 0x165, script: 0x55, flags: 0x0}, - 121: {region: 0x12f, script: 0x55, flags: 0x0}, - 122: {region: 0x52, script: 0x55, flags: 0x0}, - 123: {region: 0x99, script: 0xd3, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x20, flags: 0x0}, - 126: {region: 0x38, script: 0x1e, flags: 0x0}, - 127: {region: 0x99, script: 0x20, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x30, flags: 0x0}, - 131: {region: 0x99, script: 0x20, flags: 0x0}, - 132: {region: 0x165, script: 0x55, flags: 0x0}, - 133: {region: 0x99, script: 0x20, flags: 0x0}, - 134: {region: 0xe7, script: 0x55, flags: 0x0}, - 135: {region: 0x165, script: 0x55, flags: 0x0}, - 136: {region: 0x99, script: 0x20, flags: 0x0}, - 137: {region: 0x165, script: 0x55, flags: 0x0}, - 138: {region: 0x13f, script: 0x55, flags: 0x0}, - 139: {region: 0x165, script: 0x55, flags: 0x0}, - 140: {region: 0x165, script: 0x55, flags: 0x0}, - 141: {region: 0xe7, script: 0x55, flags: 0x0}, - 142: {region: 0x165, script: 0x55, flags: 0x0}, - 143: {region: 0xd6, script: 0x55, flags: 0x0}, - 144: {region: 0x165, script: 0x55, flags: 0x0}, - 145: {region: 0x165, script: 0x55, flags: 0x0}, - 146: {region: 0x165, script: 0x55, flags: 0x0}, - 147: {region: 0x165, script: 0x28, flags: 0x0}, - 148: {region: 0x99, script: 0x20, flags: 0x0}, - 149: {region: 0x95, script: 0x55, flags: 0x0}, - 150: {region: 0x165, script: 0x55, flags: 0x0}, - 151: {region: 0x165, script: 0x55, flags: 0x0}, - 152: {region: 0x114, script: 0x55, flags: 0x0}, - 153: {region: 0x165, script: 0x55, flags: 0x0}, - 154: {region: 0x165, script: 0x55, flags: 0x0}, - 155: {region: 0x52, script: 0x55, flags: 0x0}, - 156: {region: 0x165, script: 0x55, flags: 0x0}, - 157: {region: 0xe7, script: 0x55, flags: 0x0}, - 158: {region: 0x165, script: 0x55, flags: 0x0}, - 159: {region: 0x13e, script: 0xd5, flags: 0x0}, - 160: {region: 0xc3, script: 0x55, flags: 0x0}, - 161: {region: 0x165, script: 0x55, flags: 0x0}, - 162: {region: 0x165, script: 0x55, flags: 0x0}, - 163: {region: 0xc3, script: 0x55, flags: 0x0}, - 164: {region: 0x165, script: 0x55, flags: 0x0}, - 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x55, flags: 0x0}, - 167: {region: 0x165, script: 0x55, flags: 0x0}, - 168: {region: 0x165, script: 0x55, flags: 0x0}, - 169: {region: 0x53, script: 0xdc, flags: 0x0}, - 170: {region: 0x165, script: 0x55, flags: 0x0}, - 171: {region: 0x165, script: 0x55, flags: 0x0}, - 172: {region: 0x165, script: 0x55, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x55, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x55, flags: 0x0}, - 177: {region: 0x4f, script: 0x55, flags: 0x0}, - 178: {region: 0x78, script: 0x55, flags: 0x0}, - 179: {region: 0x99, script: 0x20, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x20, flags: 0x0}, - 182: {region: 0x165, script: 0x55, flags: 0x0}, - 183: {region: 0x33, script: 0x55, flags: 0x0}, - 184: {region: 0x165, script: 0x55, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x55, flags: 0x0}, - 187: {region: 0x165, script: 0x28, flags: 0x0}, - 188: {region: 0xe7, script: 0x55, flags: 0x0}, - 189: {region: 0x165, script: 0x55, flags: 0x0}, - 190: {region: 0xe8, script: 0x20, flags: 0x0}, - 191: {region: 0x106, script: 0x1e, flags: 0x0}, - 192: {region: 0x15f, script: 0x55, flags: 0x0}, - 193: {region: 0x165, script: 0x55, flags: 0x0}, - 194: {region: 0x95, script: 0x55, flags: 0x0}, - 195: {region: 0x165, script: 0x55, flags: 0x0}, - 196: {region: 0x52, script: 0x55, flags: 0x0}, - 197: {region: 0x165, script: 0x55, flags: 0x0}, - 198: {region: 0x165, script: 0x55, flags: 0x0}, - 199: {region: 0x165, script: 0x55, flags: 0x0}, - 200: {region: 0x86, script: 0x55, flags: 0x0}, - 201: {region: 0x165, script: 0x55, flags: 0x0}, - 202: {region: 0x165, script: 0x55, flags: 0x0}, - 203: {region: 0x165, script: 0x55, flags: 0x0}, - 204: {region: 0x165, script: 0x55, flags: 0x0}, - 205: {region: 0x6d, script: 0x28, flags: 0x0}, - 206: {region: 0x165, script: 0x55, flags: 0x0}, - 207: {region: 0x165, script: 0x55, flags: 0x0}, - 208: {region: 0x52, script: 0x55, flags: 0x0}, - 209: {region: 0x165, script: 0x55, flags: 0x0}, - 210: {region: 0x165, script: 0x55, flags: 0x0}, - 211: {region: 0xc3, script: 0x55, flags: 0x0}, - 212: {region: 0x165, script: 0x55, flags: 0x0}, - 213: {region: 0x165, script: 0x55, flags: 0x0}, - 214: {region: 0x165, script: 0x55, flags: 0x0}, - 215: {region: 0x6e, script: 0x55, flags: 0x0}, - 216: {region: 0x165, script: 0x55, flags: 0x0}, - 217: {region: 0x165, script: 0x55, flags: 0x0}, - 218: {region: 0xd6, script: 0x55, flags: 0x0}, - 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x1e, flags: 0x0}, - 221: {region: 0xe7, script: 0x55, flags: 0x0}, - 222: {region: 0x165, script: 0x55, flags: 0x0}, - 223: {region: 0x131, script: 0x55, flags: 0x0}, - 224: {region: 0x8a, script: 0x55, flags: 0x0}, - 225: {region: 0x75, script: 0x55, flags: 0x0}, - 226: {region: 0x106, script: 0x1e, flags: 0x0}, - 227: {region: 0x135, script: 0x55, flags: 0x0}, - 228: {region: 0x49, script: 0x55, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x55, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x55, flags: 0x0}, - 235: {region: 0x165, script: 0x55, flags: 0x0}, - 236: {region: 0x165, script: 0x55, flags: 0x0}, - 237: {region: 0x165, script: 0x55, flags: 0x0}, - 238: {region: 0x165, script: 0x55, flags: 0x0}, - 239: {region: 0x78, script: 0x55, flags: 0x0}, - 240: {region: 0x6b, script: 0x1c, flags: 0x0}, - 241: {region: 0xe7, script: 0x55, flags: 0x0}, - 242: {region: 0x49, script: 0x17, flags: 0x0}, - 243: {region: 0x130, script: 0x1e, flags: 0x0}, - 244: {region: 0x49, script: 0x17, flags: 0x0}, - 245: {region: 0x49, script: 0x17, flags: 0x0}, - 246: {region: 0x49, script: 0x17, flags: 0x0}, - 247: {region: 0x49, script: 0x17, flags: 0x0}, - 248: {region: 0x10a, script: 0x55, flags: 0x0}, - 249: {region: 0x5e, script: 0x55, flags: 0x0}, - 250: {region: 0xe9, script: 0x55, flags: 0x0}, - 251: {region: 0x49, script: 0x17, flags: 0x0}, - 252: {region: 0xc4, script: 0x7e, flags: 0x0}, - 253: {region: 0x8, script: 0x2, flags: 0x1}, - 254: {region: 0x106, script: 0x1e, flags: 0x0}, - 255: {region: 0x7b, script: 0x55, flags: 0x0}, - 256: {region: 0x63, script: 0x55, flags: 0x0}, - 257: {region: 0x165, script: 0x55, flags: 0x0}, - 258: {region: 0x165, script: 0x55, flags: 0x0}, - 259: {region: 0x165, script: 0x55, flags: 0x0}, - 260: {region: 0x165, script: 0x55, flags: 0x0}, - 261: {region: 0x135, script: 0x55, flags: 0x0}, - 262: {region: 0x106, script: 0x1e, flags: 0x0}, - 263: {region: 0xa4, script: 0x55, flags: 0x0}, - 264: {region: 0x165, script: 0x55, flags: 0x0}, - 265: {region: 0x165, script: 0x55, flags: 0x0}, - 266: {region: 0x99, script: 0x5, flags: 0x0}, - 267: {region: 0x165, script: 0x55, flags: 0x0}, - 268: {region: 0x60, script: 0x55, flags: 0x0}, - 269: {region: 0x165, script: 0x55, flags: 0x0}, - 270: {region: 0x49, script: 0x55, flags: 0x0}, - 271: {region: 0x165, script: 0x55, flags: 0x0}, - 272: {region: 0x165, script: 0x55, flags: 0x0}, - 273: {region: 0x165, script: 0x55, flags: 0x0}, - 274: {region: 0x165, script: 0x5, flags: 0x0}, - 275: {region: 0x49, script: 0x55, flags: 0x0}, - 276: {region: 0x165, script: 0x55, flags: 0x0}, - 277: {region: 0x165, script: 0x55, flags: 0x0}, - 278: {region: 0xd4, script: 0x55, flags: 0x0}, - 279: {region: 0x4f, script: 0x55, flags: 0x0}, - 280: {region: 0x165, script: 0x55, flags: 0x0}, - 281: {region: 0x99, script: 0x5, flags: 0x0}, - 282: {region: 0x165, script: 0x55, flags: 0x0}, - 283: {region: 0x165, script: 0x55, flags: 0x0}, - 284: {region: 0x165, script: 0x55, flags: 0x0}, - 285: {region: 0x165, script: 0x28, flags: 0x0}, - 286: {region: 0x60, script: 0x55, flags: 0x0}, - 287: {region: 0xc3, script: 0x55, flags: 0x0}, - 288: {region: 0xd0, script: 0x55, flags: 0x0}, - 289: {region: 0x165, script: 0x55, flags: 0x0}, - 290: {region: 0xdb, script: 0x20, flags: 0x0}, - 291: {region: 0x52, script: 0x55, flags: 0x0}, - 292: {region: 0x165, script: 0x55, flags: 0x0}, - 293: {region: 0x165, script: 0x55, flags: 0x0}, - 294: {region: 0x165, script: 0x55, flags: 0x0}, - 295: {region: 0xcd, script: 0xda, flags: 0x0}, - 296: {region: 0x165, script: 0x55, flags: 0x0}, - 297: {region: 0x165, script: 0x55, flags: 0x0}, - 298: {region: 0x114, script: 0x55, flags: 0x0}, - 299: {region: 0x37, script: 0x55, flags: 0x0}, - 300: {region: 0x43, script: 0xdc, flags: 0x0}, - 301: {region: 0x165, script: 0x55, flags: 0x0}, - 302: {region: 0xa4, script: 0x55, flags: 0x0}, - 303: {region: 0x80, script: 0x55, flags: 0x0}, - 304: {region: 0xd6, script: 0x55, flags: 0x0}, - 305: {region: 0x9e, script: 0x55, flags: 0x0}, - 306: {region: 0x6b, script: 0x26, flags: 0x0}, - 307: {region: 0x165, script: 0x55, flags: 0x0}, - 308: {region: 0xc4, script: 0x46, flags: 0x0}, - 309: {region: 0x87, script: 0x30, flags: 0x0}, - 310: {region: 0x165, script: 0x55, flags: 0x0}, - 311: {region: 0x165, script: 0x55, flags: 0x0}, - 312: {region: 0xa, script: 0x2, flags: 0x1}, - 313: {region: 0x165, script: 0x55, flags: 0x0}, - 314: {region: 0x165, script: 0x55, flags: 0x0}, - 315: {region: 0x1, script: 0x55, flags: 0x0}, - 316: {region: 0x165, script: 0x55, flags: 0x0}, - 317: {region: 0x6e, script: 0x55, flags: 0x0}, - 318: {region: 0x135, script: 0x55, flags: 0x0}, - 319: {region: 0x6a, script: 0x55, flags: 0x0}, - 320: {region: 0x165, script: 0x55, flags: 0x0}, - 321: {region: 0x9e, script: 0x41, flags: 0x0}, - 322: {region: 0x165, script: 0x55, flags: 0x0}, - 323: {region: 0x165, script: 0x55, flags: 0x0}, - 324: {region: 0x6e, script: 0x55, flags: 0x0}, - 325: {region: 0x52, script: 0x55, flags: 0x0}, - 326: {region: 0x6e, script: 0x55, flags: 0x0}, - 327: {region: 0x9c, script: 0x5, flags: 0x0}, - 328: {region: 0x165, script: 0x55, flags: 0x0}, - 329: {region: 0x165, script: 0x55, flags: 0x0}, - 330: {region: 0x165, script: 0x55, flags: 0x0}, - 331: {region: 0x165, script: 0x55, flags: 0x0}, - 332: {region: 0x86, script: 0x55, flags: 0x0}, - 333: {region: 0xc, script: 0x2, flags: 0x1}, - 334: {region: 0x165, script: 0x55, flags: 0x0}, - 335: {region: 0xc3, script: 0x55, flags: 0x0}, - 336: {region: 0x72, script: 0x55, flags: 0x0}, - 337: {region: 0x10b, script: 0x5, flags: 0x0}, - 338: {region: 0xe7, script: 0x55, flags: 0x0}, - 339: {region: 0x10c, script: 0x55, flags: 0x0}, - 340: {region: 0x73, script: 0x55, flags: 0x0}, - 341: {region: 0x165, script: 0x55, flags: 0x0}, - 342: {region: 0x165, script: 0x55, flags: 0x0}, - 343: {region: 0x76, script: 0x55, flags: 0x0}, - 344: {region: 0x165, script: 0x55, flags: 0x0}, - 345: {region: 0x3b, script: 0x55, flags: 0x0}, - 346: {region: 0x165, script: 0x55, flags: 0x0}, - 347: {region: 0x165, script: 0x55, flags: 0x0}, - 348: {region: 0x165, script: 0x55, flags: 0x0}, - 349: {region: 0x78, script: 0x55, flags: 0x0}, - 350: {region: 0x135, script: 0x55, flags: 0x0}, - 351: {region: 0x78, script: 0x55, flags: 0x0}, - 352: {region: 0x60, script: 0x55, flags: 0x0}, - 353: {region: 0x60, script: 0x55, flags: 0x0}, - 354: {region: 0x52, script: 0x5, flags: 0x0}, - 355: {region: 0x140, script: 0x55, flags: 0x0}, - 356: {region: 0x165, script: 0x55, flags: 0x0}, - 357: {region: 0x84, script: 0x55, flags: 0x0}, - 358: {region: 0x165, script: 0x55, flags: 0x0}, - 359: {region: 0xd4, script: 0x55, flags: 0x0}, - 360: {region: 0x9e, script: 0x55, flags: 0x0}, - 361: {region: 0xd6, script: 0x55, flags: 0x0}, - 362: {region: 0x165, script: 0x55, flags: 0x0}, - 363: {region: 0x10b, script: 0x55, flags: 0x0}, - 364: {region: 0xd9, script: 0x55, flags: 0x0}, - 365: {region: 0x96, script: 0x55, flags: 0x0}, - 366: {region: 0x80, script: 0x55, flags: 0x0}, - 367: {region: 0x165, script: 0x55, flags: 0x0}, - 368: {region: 0xbc, script: 0x55, flags: 0x0}, - 369: {region: 0x165, script: 0x55, flags: 0x0}, - 370: {region: 0x165, script: 0x55, flags: 0x0}, - 371: {region: 0x165, script: 0x55, flags: 0x0}, - 372: {region: 0x53, script: 0x37, flags: 0x0}, - 373: {region: 0x165, script: 0x55, flags: 0x0}, - 374: {region: 0x95, script: 0x55, flags: 0x0}, - 375: {region: 0x165, script: 0x55, flags: 0x0}, - 376: {region: 0x99, script: 0x20, flags: 0x0}, - 377: {region: 0x165, script: 0x55, flags: 0x0}, - 378: {region: 0x9c, script: 0x5, flags: 0x0}, - 379: {region: 0x7e, script: 0x55, flags: 0x0}, - 380: {region: 0x7b, script: 0x55, flags: 0x0}, - 381: {region: 0x165, script: 0x55, flags: 0x0}, - 382: {region: 0x165, script: 0x55, flags: 0x0}, - 383: {region: 0x165, script: 0x55, flags: 0x0}, - 384: {region: 0x165, script: 0x55, flags: 0x0}, - 385: {region: 0x165, script: 0x55, flags: 0x0}, - 386: {region: 0x165, script: 0x55, flags: 0x0}, - 387: {region: 0x6f, script: 0x28, flags: 0x0}, - 388: {region: 0x165, script: 0x55, flags: 0x0}, - 389: {region: 0xdb, script: 0x20, flags: 0x0}, - 390: {region: 0x165, script: 0x55, flags: 0x0}, - 391: {region: 0xa7, script: 0x55, flags: 0x0}, - 392: {region: 0x165, script: 0x55, flags: 0x0}, - 393: {region: 0xe8, script: 0x5, flags: 0x0}, - 394: {region: 0x165, script: 0x55, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x55, flags: 0x0}, - 397: {region: 0x165, script: 0x55, flags: 0x0}, - 398: {region: 0x6e, script: 0x55, flags: 0x0}, - 399: {region: 0x9c, script: 0x5, flags: 0x0}, - 400: {region: 0x165, script: 0x55, flags: 0x0}, - 401: {region: 0x165, script: 0x28, flags: 0x0}, - 402: {region: 0xf1, script: 0x55, flags: 0x0}, - 403: {region: 0x165, script: 0x55, flags: 0x0}, - 404: {region: 0x165, script: 0x55, flags: 0x0}, - 405: {region: 0x165, script: 0x55, flags: 0x0}, - 406: {region: 0x165, script: 0x28, flags: 0x0}, - 407: {region: 0x165, script: 0x55, flags: 0x0}, - 408: {region: 0x99, script: 0x20, flags: 0x0}, - 409: {region: 0x99, script: 0xd6, flags: 0x0}, - 410: {region: 0x95, script: 0x55, flags: 0x0}, - 411: {region: 0xd9, script: 0x55, flags: 0x0}, - 412: {region: 0x130, script: 0x2e, flags: 0x0}, - 413: {region: 0x165, script: 0x55, flags: 0x0}, - 414: {region: 0xe, script: 0x2, flags: 0x1}, - 415: {region: 0x99, script: 0xe, flags: 0x0}, - 416: {region: 0x165, script: 0x55, flags: 0x0}, - 417: {region: 0x4e, script: 0x55, flags: 0x0}, - 418: {region: 0x99, script: 0x31, flags: 0x0}, - 419: {region: 0x41, script: 0x55, flags: 0x0}, - 420: {region: 0x54, script: 0x55, flags: 0x0}, - 421: {region: 0x165, script: 0x55, flags: 0x0}, - 422: {region: 0x80, script: 0x55, flags: 0x0}, - 423: {region: 0x165, script: 0x55, flags: 0x0}, - 424: {region: 0x165, script: 0x55, flags: 0x0}, - 425: {region: 0xa4, script: 0x55, flags: 0x0}, - 426: {region: 0x98, script: 0x55, flags: 0x0}, - 427: {region: 0x165, script: 0x55, flags: 0x0}, - 428: {region: 0xdb, script: 0x20, flags: 0x0}, - 429: {region: 0x165, script: 0x55, flags: 0x0}, - 430: {region: 0x165, script: 0x5, flags: 0x0}, - 431: {region: 0x49, script: 0x55, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x165, script: 0x55, flags: 0x0}, - 434: {region: 0x10, script: 0x3, flags: 0x1}, - 435: {region: 0x165, script: 0x55, flags: 0x0}, - 436: {region: 0x53, script: 0x37, flags: 0x0}, - 437: {region: 0x165, script: 0x55, flags: 0x0}, - 438: {region: 0x135, script: 0x55, flags: 0x0}, - 439: {region: 0x24, script: 0x5, flags: 0x0}, - 440: {region: 0x165, script: 0x55, flags: 0x0}, - 441: {region: 0x165, script: 0x28, flags: 0x0}, - 442: {region: 0x97, script: 0x3a, flags: 0x0}, - 443: {region: 0x165, script: 0x55, flags: 0x0}, - 444: {region: 0x99, script: 0x20, flags: 0x0}, - 445: {region: 0x165, script: 0x55, flags: 0x0}, - 446: {region: 0x73, script: 0x55, flags: 0x0}, - 447: {region: 0x165, script: 0x55, flags: 0x0}, - 448: {region: 0x165, script: 0x55, flags: 0x0}, - 449: {region: 0xe7, script: 0x55, flags: 0x0}, - 450: {region: 0x165, script: 0x55, flags: 0x0}, - 451: {region: 0x12b, script: 0x3c, flags: 0x0}, - 452: {region: 0x53, script: 0x86, flags: 0x0}, - 453: {region: 0x165, script: 0x55, flags: 0x0}, - 454: {region: 0xe8, script: 0x5, flags: 0x0}, - 455: {region: 0x99, script: 0x20, flags: 0x0}, - 456: {region: 0xaf, script: 0x3d, flags: 0x0}, - 457: {region: 0xe7, script: 0x55, flags: 0x0}, - 458: {region: 0xe8, script: 0x5, flags: 0x0}, - 459: {region: 0xe6, script: 0x55, flags: 0x0}, - 460: {region: 0x99, script: 0x20, flags: 0x0}, - 461: {region: 0x99, script: 0x20, flags: 0x0}, - 462: {region: 0x165, script: 0x55, flags: 0x0}, - 463: {region: 0x90, script: 0x55, flags: 0x0}, - 464: {region: 0x60, script: 0x55, flags: 0x0}, - 465: {region: 0x53, script: 0x37, flags: 0x0}, - 466: {region: 0x91, script: 0x55, flags: 0x0}, - 467: {region: 0x92, script: 0x55, flags: 0x0}, - 468: {region: 0x165, script: 0x55, flags: 0x0}, - 469: {region: 0x28, script: 0x8, flags: 0x0}, - 470: {region: 0xd2, script: 0x55, flags: 0x0}, - 471: {region: 0x78, script: 0x55, flags: 0x0}, - 472: {region: 0x165, script: 0x55, flags: 0x0}, - 473: {region: 0x165, script: 0x55, flags: 0x0}, - 474: {region: 0xd0, script: 0x55, flags: 0x0}, - 475: {region: 0xd6, script: 0x55, flags: 0x0}, - 476: {region: 0x165, script: 0x55, flags: 0x0}, - 477: {region: 0x165, script: 0x55, flags: 0x0}, - 478: {region: 0x165, script: 0x55, flags: 0x0}, - 479: {region: 0x95, script: 0x55, flags: 0x0}, - 480: {region: 0x165, script: 0x55, flags: 0x0}, - 481: {region: 0x165, script: 0x55, flags: 0x0}, - 482: {region: 0x165, script: 0x55, flags: 0x0}, - 484: {region: 0x122, script: 0x55, flags: 0x0}, - 485: {region: 0xd6, script: 0x55, flags: 0x0}, - 486: {region: 0x165, script: 0x55, flags: 0x0}, - 487: {region: 0x165, script: 0x55, flags: 0x0}, - 488: {region: 0x53, script: 0xe5, flags: 0x0}, - 489: {region: 0x165, script: 0x55, flags: 0x0}, - 490: {region: 0x135, script: 0x55, flags: 0x0}, - 491: {region: 0x165, script: 0x55, flags: 0x0}, - 492: {region: 0x49, script: 0x55, flags: 0x0}, - 493: {region: 0x165, script: 0x55, flags: 0x0}, - 494: {region: 0x165, script: 0x55, flags: 0x0}, - 495: {region: 0xe7, script: 0x55, flags: 0x0}, - 496: {region: 0x165, script: 0x55, flags: 0x0}, - 497: {region: 0x95, script: 0x55, flags: 0x0}, - 498: {region: 0x106, script: 0x1e, flags: 0x0}, - 500: {region: 0x165, script: 0x55, flags: 0x0}, - 501: {region: 0x165, script: 0x55, flags: 0x0}, - 502: {region: 0x9d, script: 0x55, flags: 0x0}, - 503: {region: 0x9e, script: 0x55, flags: 0x0}, - 504: {region: 0x49, script: 0x17, flags: 0x0}, - 505: {region: 0x97, script: 0x3a, flags: 0x0}, - 506: {region: 0x165, script: 0x55, flags: 0x0}, - 507: {region: 0x165, script: 0x55, flags: 0x0}, - 508: {region: 0x106, script: 0x55, flags: 0x0}, - 509: {region: 0x165, script: 0x55, flags: 0x0}, - 510: {region: 0xa2, script: 0x44, flags: 0x0}, - 511: {region: 0x165, script: 0x55, flags: 0x0}, - 512: {region: 0xa0, script: 0x55, flags: 0x0}, - 514: {region: 0x165, script: 0x55, flags: 0x0}, - 515: {region: 0x165, script: 0x55, flags: 0x0}, - 516: {region: 0x165, script: 0x55, flags: 0x0}, - 517: {region: 0x52, script: 0x55, flags: 0x0}, - 518: {region: 0x130, script: 0x3a, flags: 0x0}, - 519: {region: 0x165, script: 0x55, flags: 0x0}, - 520: {region: 0x12f, script: 0x55, flags: 0x0}, - 521: {region: 0xdb, script: 0x20, flags: 0x0}, - 522: {region: 0x165, script: 0x55, flags: 0x0}, - 523: {region: 0x63, script: 0x55, flags: 0x0}, - 524: {region: 0x95, script: 0x55, flags: 0x0}, - 525: {region: 0x95, script: 0x55, flags: 0x0}, - 526: {region: 0x7d, script: 0x2a, flags: 0x0}, - 527: {region: 0x137, script: 0x1e, flags: 0x0}, - 528: {region: 0x67, script: 0x55, flags: 0x0}, - 529: {region: 0xc4, script: 0x55, flags: 0x0}, - 530: {region: 0x165, script: 0x55, flags: 0x0}, - 531: {region: 0x165, script: 0x55, flags: 0x0}, - 532: {region: 0xd6, script: 0x55, flags: 0x0}, - 533: {region: 0xa4, script: 0x55, flags: 0x0}, - 534: {region: 0xc3, script: 0x55, flags: 0x0}, - 535: {region: 0x106, script: 0x1e, flags: 0x0}, - 536: {region: 0x165, script: 0x55, flags: 0x0}, - 537: {region: 0x165, script: 0x55, flags: 0x0}, - 538: {region: 0x165, script: 0x55, flags: 0x0}, - 539: {region: 0x165, script: 0x55, flags: 0x0}, - 540: {region: 0xd4, script: 0x5, flags: 0x0}, - 541: {region: 0xd6, script: 0x55, flags: 0x0}, - 542: {region: 0x164, script: 0x55, flags: 0x0}, - 543: {region: 0x165, script: 0x55, flags: 0x0}, - 544: {region: 0x165, script: 0x55, flags: 0x0}, - 545: {region: 0x12f, script: 0x55, flags: 0x0}, - 546: {region: 0x122, script: 0x5, flags: 0x0}, - 547: {region: 0x165, script: 0x55, flags: 0x0}, - 548: {region: 0x123, script: 0xdb, flags: 0x0}, - 549: {region: 0x5a, script: 0x55, flags: 0x0}, - 550: {region: 0x52, script: 0x55, flags: 0x0}, - 551: {region: 0x165, script: 0x55, flags: 0x0}, - 552: {region: 0x4f, script: 0x55, flags: 0x0}, - 553: {region: 0x99, script: 0x20, flags: 0x0}, - 554: {region: 0x99, script: 0x20, flags: 0x0}, - 555: {region: 0x4b, script: 0x55, flags: 0x0}, - 556: {region: 0x95, script: 0x55, flags: 0x0}, - 557: {region: 0x165, script: 0x55, flags: 0x0}, - 558: {region: 0x41, script: 0x55, flags: 0x0}, - 559: {region: 0x99, script: 0x55, flags: 0x0}, - 560: {region: 0x53, script: 0xd2, flags: 0x0}, - 561: {region: 0x99, script: 0x20, flags: 0x0}, - 562: {region: 0xc3, script: 0x55, flags: 0x0}, - 563: {region: 0x165, script: 0x55, flags: 0x0}, - 564: {region: 0x99, script: 0x70, flags: 0x0}, - 565: {region: 0xe8, script: 0x5, flags: 0x0}, - 566: {region: 0x165, script: 0x55, flags: 0x0}, - 567: {region: 0xa4, script: 0x55, flags: 0x0}, - 568: {region: 0x165, script: 0x55, flags: 0x0}, - 569: {region: 0x12b, script: 0x55, flags: 0x0}, - 570: {region: 0x165, script: 0x55, flags: 0x0}, - 571: {region: 0xd2, script: 0x55, flags: 0x0}, - 572: {region: 0x165, script: 0x55, flags: 0x0}, - 573: {region: 0xaf, script: 0x52, flags: 0x0}, - 574: {region: 0x165, script: 0x55, flags: 0x0}, - 575: {region: 0x165, script: 0x55, flags: 0x0}, - 576: {region: 0x13, script: 0x6, flags: 0x1}, - 577: {region: 0x165, script: 0x55, flags: 0x0}, - 578: {region: 0x52, script: 0x55, flags: 0x0}, - 579: {region: 0x82, script: 0x55, flags: 0x0}, - 580: {region: 0xa4, script: 0x55, flags: 0x0}, - 581: {region: 0x165, script: 0x55, flags: 0x0}, - 582: {region: 0x165, script: 0x55, flags: 0x0}, - 583: {region: 0x165, script: 0x55, flags: 0x0}, - 584: {region: 0xa6, script: 0x49, flags: 0x0}, - 585: {region: 0x2a, script: 0x55, flags: 0x0}, - 586: {region: 0x165, script: 0x55, flags: 0x0}, - 587: {region: 0x165, script: 0x55, flags: 0x0}, - 588: {region: 0x165, script: 0x55, flags: 0x0}, - 589: {region: 0x165, script: 0x55, flags: 0x0}, - 590: {region: 0x165, script: 0x55, flags: 0x0}, - 591: {region: 0x99, script: 0x4d, flags: 0x0}, - 592: {region: 0x114, script: 0x55, flags: 0x0}, - 593: {region: 0x165, script: 0x55, flags: 0x0}, - 594: {region: 0xab, script: 0x4e, flags: 0x0}, - 595: {region: 0x106, script: 0x1e, flags: 0x0}, - 596: {region: 0x99, script: 0x20, flags: 0x0}, - 597: {region: 0x165, script: 0x55, flags: 0x0}, - 598: {region: 0x75, script: 0x55, flags: 0x0}, - 599: {region: 0x165, script: 0x55, flags: 0x0}, - 600: {region: 0xb4, script: 0x55, flags: 0x0}, - 601: {region: 0x165, script: 0x55, flags: 0x0}, - 602: {region: 0x165, script: 0x55, flags: 0x0}, - 603: {region: 0x165, script: 0x55, flags: 0x0}, - 604: {region: 0x165, script: 0x55, flags: 0x0}, - 605: {region: 0x165, script: 0x55, flags: 0x0}, - 606: {region: 0x165, script: 0x55, flags: 0x0}, - 607: {region: 0x165, script: 0x55, flags: 0x0}, - 608: {region: 0x165, script: 0x28, flags: 0x0}, - 610: {region: 0x106, script: 0x1e, flags: 0x0}, - 611: {region: 0x112, script: 0x55, flags: 0x0}, - 612: {region: 0xe7, script: 0x55, flags: 0x0}, - 613: {region: 0x106, script: 0x55, flags: 0x0}, - 614: {region: 0x165, script: 0x55, flags: 0x0}, - 615: {region: 0x99, script: 0x20, flags: 0x0}, - 616: {region: 0x99, script: 0x5, flags: 0x0}, - 617: {region: 0x12f, script: 0x55, flags: 0x0}, - 618: {region: 0x165, script: 0x55, flags: 0x0}, - 619: {region: 0x52, script: 0x55, flags: 0x0}, - 620: {region: 0x60, script: 0x55, flags: 0x0}, - 621: {region: 0x165, script: 0x55, flags: 0x0}, - 622: {region: 0x165, script: 0x55, flags: 0x0}, - 623: {region: 0x165, script: 0x28, flags: 0x0}, - 624: {region: 0x165, script: 0x55, flags: 0x0}, - 625: {region: 0x165, script: 0x55, flags: 0x0}, - 626: {region: 0x19, script: 0x3, flags: 0x1}, - 627: {region: 0x165, script: 0x55, flags: 0x0}, - 628: {region: 0x165, script: 0x55, flags: 0x0}, - 629: {region: 0x165, script: 0x55, flags: 0x0}, - 630: {region: 0x165, script: 0x55, flags: 0x0}, - 631: {region: 0x106, script: 0x1e, flags: 0x0}, - 632: {region: 0x165, script: 0x55, flags: 0x0}, - 633: {region: 0x165, script: 0x55, flags: 0x0}, - 634: {region: 0x165, script: 0x55, flags: 0x0}, - 635: {region: 0x106, script: 0x1e, flags: 0x0}, - 636: {region: 0x165, script: 0x55, flags: 0x0}, - 637: {region: 0x95, script: 0x55, flags: 0x0}, - 638: {region: 0xe8, script: 0x5, flags: 0x0}, - 639: {region: 0x7b, script: 0x55, flags: 0x0}, - 640: {region: 0x165, script: 0x55, flags: 0x0}, - 641: {region: 0x165, script: 0x55, flags: 0x0}, - 642: {region: 0x165, script: 0x55, flags: 0x0}, - 643: {region: 0x165, script: 0x28, flags: 0x0}, - 644: {region: 0x123, script: 0xdb, flags: 0x0}, - 645: {region: 0xe8, script: 0x5, flags: 0x0}, - 646: {region: 0x165, script: 0x55, flags: 0x0}, - 647: {region: 0x165, script: 0x55, flags: 0x0}, - 648: {region: 0x1c, script: 0x5, flags: 0x1}, - 649: {region: 0x165, script: 0x55, flags: 0x0}, - 650: {region: 0x165, script: 0x55, flags: 0x0}, - 651: {region: 0x165, script: 0x55, flags: 0x0}, - 652: {region: 0x138, script: 0x55, flags: 0x0}, - 653: {region: 0x87, script: 0x59, flags: 0x0}, - 654: {region: 0x97, script: 0x3a, flags: 0x0}, - 655: {region: 0x12f, script: 0x55, flags: 0x0}, - 656: {region: 0xe8, script: 0x5, flags: 0x0}, - 657: {region: 0x131, script: 0x55, flags: 0x0}, - 658: {region: 0x165, script: 0x55, flags: 0x0}, - 659: {region: 0xb7, script: 0x55, flags: 0x0}, - 660: {region: 0x106, script: 0x1e, flags: 0x0}, - 661: {region: 0x165, script: 0x55, flags: 0x0}, - 662: {region: 0x95, script: 0x55, flags: 0x0}, - 663: {region: 0x165, script: 0x55, flags: 0x0}, - 664: {region: 0x53, script: 0xdb, flags: 0x0}, - 665: {region: 0x165, script: 0x55, flags: 0x0}, - 666: {region: 0x165, script: 0x55, flags: 0x0}, - 667: {region: 0x165, script: 0x55, flags: 0x0}, - 668: {region: 0x165, script: 0x55, flags: 0x0}, - 669: {region: 0x99, script: 0x57, flags: 0x0}, - 670: {region: 0x165, script: 0x55, flags: 0x0}, - 671: {region: 0x165, script: 0x55, flags: 0x0}, - 672: {region: 0x106, script: 0x1e, flags: 0x0}, - 673: {region: 0x131, script: 0x55, flags: 0x0}, - 674: {region: 0x165, script: 0x55, flags: 0x0}, - 675: {region: 0xd9, script: 0x55, flags: 0x0}, - 676: {region: 0x165, script: 0x55, flags: 0x0}, - 677: {region: 0x165, script: 0x55, flags: 0x0}, - 678: {region: 0x21, script: 0x2, flags: 0x1}, - 679: {region: 0x165, script: 0x55, flags: 0x0}, - 680: {region: 0x165, script: 0x55, flags: 0x0}, - 681: {region: 0x9e, script: 0x55, flags: 0x0}, - 682: {region: 0x53, script: 0x5b, flags: 0x0}, - 683: {region: 0x95, script: 0x55, flags: 0x0}, - 684: {region: 0x9c, script: 0x5, flags: 0x0}, - 685: {region: 0x135, script: 0x55, flags: 0x0}, - 686: {region: 0x165, script: 0x55, flags: 0x0}, - 687: {region: 0x165, script: 0x55, flags: 0x0}, - 688: {region: 0x99, script: 0xd6, flags: 0x0}, - 689: {region: 0x9e, script: 0x55, flags: 0x0}, - 690: {region: 0x165, script: 0x55, flags: 0x0}, - 691: {region: 0x4b, script: 0x55, flags: 0x0}, - 692: {region: 0x165, script: 0x55, flags: 0x0}, - 693: {region: 0x165, script: 0x55, flags: 0x0}, - 694: {region: 0xaf, script: 0x52, flags: 0x0}, - 695: {region: 0x165, script: 0x55, flags: 0x0}, - 696: {region: 0x165, script: 0x55, flags: 0x0}, - 697: {region: 0x4b, script: 0x55, flags: 0x0}, - 698: {region: 0x165, script: 0x55, flags: 0x0}, - 699: {region: 0x165, script: 0x55, flags: 0x0}, - 700: {region: 0x162, script: 0x55, flags: 0x0}, - 701: {region: 0x9c, script: 0x5, flags: 0x0}, - 702: {region: 0xb6, script: 0x55, flags: 0x0}, - 703: {region: 0xb8, script: 0x55, flags: 0x0}, - 704: {region: 0x4b, script: 0x55, flags: 0x0}, - 705: {region: 0x4b, script: 0x55, flags: 0x0}, - 706: {region: 0xa4, script: 0x55, flags: 0x0}, - 707: {region: 0xa4, script: 0x55, flags: 0x0}, - 708: {region: 0x9c, script: 0x5, flags: 0x0}, - 709: {region: 0xb8, script: 0x55, flags: 0x0}, - 710: {region: 0x123, script: 0xdb, flags: 0x0}, - 711: {region: 0x53, script: 0x37, flags: 0x0}, - 712: {region: 0x12b, script: 0x55, flags: 0x0}, - 713: {region: 0x95, script: 0x55, flags: 0x0}, - 714: {region: 0x52, script: 0x55, flags: 0x0}, - 715: {region: 0x99, script: 0x20, flags: 0x0}, - 716: {region: 0x99, script: 0x20, flags: 0x0}, - 717: {region: 0x95, script: 0x55, flags: 0x0}, - 718: {region: 0x23, script: 0x3, flags: 0x1}, - 719: {region: 0xa4, script: 0x55, flags: 0x0}, - 720: {region: 0x165, script: 0x55, flags: 0x0}, - 721: {region: 0xcf, script: 0x55, flags: 0x0}, - 722: {region: 0x165, script: 0x55, flags: 0x0}, - 723: {region: 0x165, script: 0x55, flags: 0x0}, - 724: {region: 0x165, script: 0x55, flags: 0x0}, - 725: {region: 0x165, script: 0x55, flags: 0x0}, - 726: {region: 0x165, script: 0x55, flags: 0x0}, - 727: {region: 0x165, script: 0x55, flags: 0x0}, - 728: {region: 0x165, script: 0x55, flags: 0x0}, - 729: {region: 0x165, script: 0x55, flags: 0x0}, - 730: {region: 0x165, script: 0x55, flags: 0x0}, - 731: {region: 0x165, script: 0x55, flags: 0x0}, - 732: {region: 0x165, script: 0x55, flags: 0x0}, - 733: {region: 0x165, script: 0x5, flags: 0x0}, - 734: {region: 0x106, script: 0x1e, flags: 0x0}, - 735: {region: 0xe7, script: 0x55, flags: 0x0}, - 736: {region: 0x165, script: 0x55, flags: 0x0}, - 737: {region: 0x95, script: 0x55, flags: 0x0}, - 738: {region: 0x165, script: 0x28, flags: 0x0}, - 739: {region: 0x165, script: 0x55, flags: 0x0}, - 740: {region: 0x165, script: 0x55, flags: 0x0}, - 741: {region: 0x165, script: 0x55, flags: 0x0}, - 742: {region: 0x112, script: 0x55, flags: 0x0}, - 743: {region: 0xa4, script: 0x55, flags: 0x0}, - 744: {region: 0x165, script: 0x55, flags: 0x0}, - 745: {region: 0x165, script: 0x55, flags: 0x0}, - 746: {region: 0x123, script: 0x5, flags: 0x0}, - 747: {region: 0xcc, script: 0x55, flags: 0x0}, - 748: {region: 0x165, script: 0x55, flags: 0x0}, - 749: {region: 0x165, script: 0x55, flags: 0x0}, - 750: {region: 0x165, script: 0x55, flags: 0x0}, - 751: {region: 0xbf, script: 0x55, flags: 0x0}, - 752: {region: 0xd1, script: 0x55, flags: 0x0}, - 753: {region: 0x165, script: 0x55, flags: 0x0}, - 754: {region: 0x52, script: 0x55, flags: 0x0}, - 755: {region: 0xdb, script: 0x20, flags: 0x0}, - 756: {region: 0x12f, script: 0x55, flags: 0x0}, - 757: {region: 0xc0, script: 0x55, flags: 0x0}, - 758: {region: 0x165, script: 0x55, flags: 0x0}, - 759: {region: 0x165, script: 0x55, flags: 0x0}, - 760: {region: 0xe0, script: 0x55, flags: 0x0}, - 761: {region: 0x165, script: 0x55, flags: 0x0}, - 762: {region: 0x95, script: 0x55, flags: 0x0}, - 763: {region: 0x9b, script: 0x39, flags: 0x0}, - 764: {region: 0x165, script: 0x55, flags: 0x0}, - 765: {region: 0xc2, script: 0x1e, flags: 0x0}, - 766: {region: 0x165, script: 0x5, flags: 0x0}, - 767: {region: 0x165, script: 0x55, flags: 0x0}, - 768: {region: 0x165, script: 0x55, flags: 0x0}, - 769: {region: 0x165, script: 0x55, flags: 0x0}, - 770: {region: 0x99, script: 0x69, flags: 0x0}, - 771: {region: 0x165, script: 0x55, flags: 0x0}, - 772: {region: 0x165, script: 0x55, flags: 0x0}, - 773: {region: 0x10b, script: 0x55, flags: 0x0}, - 774: {region: 0x165, script: 0x55, flags: 0x0}, - 775: {region: 0x165, script: 0x55, flags: 0x0}, - 776: {region: 0x165, script: 0x55, flags: 0x0}, - 777: {region: 0x26, script: 0x3, flags: 0x1}, - 778: {region: 0x165, script: 0x55, flags: 0x0}, - 779: {region: 0x165, script: 0x55, flags: 0x0}, - 780: {region: 0x99, script: 0xe, flags: 0x0}, - 781: {region: 0xc4, script: 0x70, flags: 0x0}, - 783: {region: 0x165, script: 0x55, flags: 0x0}, - 784: {region: 0x49, script: 0x55, flags: 0x0}, - 785: {region: 0x49, script: 0x55, flags: 0x0}, - 786: {region: 0x37, script: 0x55, flags: 0x0}, - 787: {region: 0x165, script: 0x55, flags: 0x0}, - 788: {region: 0x165, script: 0x55, flags: 0x0}, - 789: {region: 0x165, script: 0x55, flags: 0x0}, - 790: {region: 0x165, script: 0x55, flags: 0x0}, - 791: {region: 0x165, script: 0x55, flags: 0x0}, - 792: {region: 0x165, script: 0x55, flags: 0x0}, - 793: {region: 0x99, script: 0x20, flags: 0x0}, - 794: {region: 0xdb, script: 0x20, flags: 0x0}, - 795: {region: 0x106, script: 0x1e, flags: 0x0}, - 796: {region: 0x35, script: 0x6d, flags: 0x0}, - 797: {region: 0x29, script: 0x3, flags: 0x1}, - 798: {region: 0xcb, script: 0x55, flags: 0x0}, - 799: {region: 0x165, script: 0x55, flags: 0x0}, - 800: {region: 0x165, script: 0x55, flags: 0x0}, - 801: {region: 0x165, script: 0x55, flags: 0x0}, - 802: {region: 0x99, script: 0x20, flags: 0x0}, - 803: {region: 0x52, script: 0x55, flags: 0x0}, - 805: {region: 0x165, script: 0x55, flags: 0x0}, - 806: {region: 0x135, script: 0x55, flags: 0x0}, - 807: {region: 0x165, script: 0x55, flags: 0x0}, - 808: {region: 0x165, script: 0x55, flags: 0x0}, - 809: {region: 0xe8, script: 0x5, flags: 0x0}, - 810: {region: 0xc3, script: 0x55, flags: 0x0}, - 811: {region: 0x99, script: 0x20, flags: 0x0}, - 812: {region: 0x95, script: 0x55, flags: 0x0}, - 813: {region: 0x164, script: 0x55, flags: 0x0}, - 814: {region: 0x165, script: 0x55, flags: 0x0}, - 815: {region: 0xc4, script: 0x70, flags: 0x0}, - 816: {region: 0x165, script: 0x55, flags: 0x0}, - 817: {region: 0x165, script: 0x28, flags: 0x0}, - 818: {region: 0x106, script: 0x1e, flags: 0x0}, - 819: {region: 0x165, script: 0x55, flags: 0x0}, - 820: {region: 0x131, script: 0x55, flags: 0x0}, - 821: {region: 0x9c, script: 0x61, flags: 0x0}, - 822: {region: 0x165, script: 0x55, flags: 0x0}, - 823: {region: 0x165, script: 0x55, flags: 0x0}, - 824: {region: 0x9c, script: 0x5, flags: 0x0}, - 825: {region: 0x165, script: 0x55, flags: 0x0}, - 826: {region: 0x165, script: 0x55, flags: 0x0}, - 827: {region: 0x165, script: 0x55, flags: 0x0}, - 828: {region: 0xdd, script: 0x55, flags: 0x0}, - 829: {region: 0x165, script: 0x55, flags: 0x0}, - 830: {region: 0x165, script: 0x55, flags: 0x0}, - 832: {region: 0x165, script: 0x55, flags: 0x0}, - 833: {region: 0x53, script: 0x37, flags: 0x0}, - 834: {region: 0x9e, script: 0x55, flags: 0x0}, - 835: {region: 0xd2, script: 0x55, flags: 0x0}, - 836: {region: 0x165, script: 0x55, flags: 0x0}, - 837: {region: 0xda, script: 0x55, flags: 0x0}, - 838: {region: 0x165, script: 0x55, flags: 0x0}, - 839: {region: 0x165, script: 0x55, flags: 0x0}, - 840: {region: 0x165, script: 0x55, flags: 0x0}, - 841: {region: 0xcf, script: 0x55, flags: 0x0}, - 842: {region: 0x165, script: 0x55, flags: 0x0}, - 843: {region: 0x165, script: 0x55, flags: 0x0}, - 844: {region: 0x164, script: 0x55, flags: 0x0}, - 845: {region: 0xd1, script: 0x55, flags: 0x0}, - 846: {region: 0x60, script: 0x55, flags: 0x0}, - 847: {region: 0xdb, script: 0x20, flags: 0x0}, - 848: {region: 0x165, script: 0x55, flags: 0x0}, - 849: {region: 0xdb, script: 0x20, flags: 0x0}, - 850: {region: 0x165, script: 0x55, flags: 0x0}, - 851: {region: 0x165, script: 0x55, flags: 0x0}, - 852: {region: 0xd2, script: 0x55, flags: 0x0}, - 853: {region: 0x165, script: 0x55, flags: 0x0}, - 854: {region: 0x165, script: 0x55, flags: 0x0}, - 855: {region: 0xd1, script: 0x55, flags: 0x0}, - 856: {region: 0x165, script: 0x55, flags: 0x0}, - 857: {region: 0xcf, script: 0x55, flags: 0x0}, - 858: {region: 0xcf, script: 0x55, flags: 0x0}, - 859: {region: 0x165, script: 0x55, flags: 0x0}, - 860: {region: 0x165, script: 0x55, flags: 0x0}, - 861: {region: 0x95, script: 0x55, flags: 0x0}, - 862: {region: 0x165, script: 0x55, flags: 0x0}, - 863: {region: 0xdf, script: 0x55, flags: 0x0}, - 864: {region: 0x165, script: 0x55, flags: 0x0}, - 865: {region: 0x165, script: 0x55, flags: 0x0}, - 866: {region: 0x99, script: 0x55, flags: 0x0}, - 867: {region: 0x165, script: 0x55, flags: 0x0}, - 868: {region: 0x165, script: 0x55, flags: 0x0}, - 869: {region: 0xd9, script: 0x55, flags: 0x0}, - 870: {region: 0x52, script: 0x55, flags: 0x0}, - 871: {region: 0x165, script: 0x55, flags: 0x0}, - 872: {region: 0xda, script: 0x55, flags: 0x0}, - 873: {region: 0x165, script: 0x55, flags: 0x0}, - 874: {region: 0x52, script: 0x55, flags: 0x0}, - 875: {region: 0x165, script: 0x55, flags: 0x0}, - 876: {region: 0x165, script: 0x55, flags: 0x0}, - 877: {region: 0xda, script: 0x55, flags: 0x0}, - 878: {region: 0x123, script: 0x51, flags: 0x0}, - 879: {region: 0x99, script: 0x20, flags: 0x0}, - 880: {region: 0x10c, script: 0xbc, flags: 0x0}, - 881: {region: 0x165, script: 0x55, flags: 0x0}, - 882: {region: 0x165, script: 0x55, flags: 0x0}, - 883: {region: 0x84, script: 0x75, flags: 0x0}, - 884: {region: 0x161, script: 0x55, flags: 0x0}, - 885: {region: 0x165, script: 0x55, flags: 0x0}, - 886: {region: 0x49, script: 0x17, flags: 0x0}, - 887: {region: 0x165, script: 0x55, flags: 0x0}, - 888: {region: 0x161, script: 0x55, flags: 0x0}, - 889: {region: 0x165, script: 0x55, flags: 0x0}, - 890: {region: 0x165, script: 0x55, flags: 0x0}, - 891: {region: 0x165, script: 0x55, flags: 0x0}, - 892: {region: 0x165, script: 0x55, flags: 0x0}, - 893: {region: 0x165, script: 0x55, flags: 0x0}, - 894: {region: 0x117, script: 0x55, flags: 0x0}, - 895: {region: 0x165, script: 0x55, flags: 0x0}, - 896: {region: 0x165, script: 0x55, flags: 0x0}, - 897: {region: 0x135, script: 0x55, flags: 0x0}, - 898: {region: 0x165, script: 0x55, flags: 0x0}, - 899: {region: 0x53, script: 0x55, flags: 0x0}, - 900: {region: 0x165, script: 0x55, flags: 0x0}, - 901: {region: 0xce, script: 0x55, flags: 0x0}, - 902: {region: 0x12f, script: 0x55, flags: 0x0}, - 903: {region: 0x131, script: 0x55, flags: 0x0}, - 904: {region: 0x80, script: 0x55, flags: 0x0}, - 905: {region: 0x78, script: 0x55, flags: 0x0}, - 906: {region: 0x165, script: 0x55, flags: 0x0}, - 908: {region: 0x165, script: 0x55, flags: 0x0}, - 909: {region: 0x165, script: 0x55, flags: 0x0}, - 910: {region: 0x6f, script: 0x55, flags: 0x0}, - 911: {region: 0x165, script: 0x55, flags: 0x0}, - 912: {region: 0x165, script: 0x55, flags: 0x0}, - 913: {region: 0x165, script: 0x55, flags: 0x0}, - 914: {region: 0x165, script: 0x55, flags: 0x0}, - 915: {region: 0x99, script: 0x7a, flags: 0x0}, - 916: {region: 0x165, script: 0x55, flags: 0x0}, - 917: {region: 0x165, script: 0x5, flags: 0x0}, - 918: {region: 0x7d, script: 0x1e, flags: 0x0}, - 919: {region: 0x135, script: 0x7b, flags: 0x0}, - 920: {region: 0x165, script: 0x5, flags: 0x0}, - 921: {region: 0xc5, script: 0x79, flags: 0x0}, - 922: {region: 0x165, script: 0x55, flags: 0x0}, - 923: {region: 0x2c, script: 0x3, flags: 0x1}, - 924: {region: 0xe7, script: 0x55, flags: 0x0}, - 925: {region: 0x2f, script: 0x2, flags: 0x1}, - 926: {region: 0xe7, script: 0x55, flags: 0x0}, - 927: {region: 0x30, script: 0x55, flags: 0x0}, - 928: {region: 0xf0, script: 0x55, flags: 0x0}, - 929: {region: 0x165, script: 0x55, flags: 0x0}, - 930: {region: 0x78, script: 0x55, flags: 0x0}, - 931: {region: 0xd6, script: 0x55, flags: 0x0}, - 932: {region: 0x135, script: 0x55, flags: 0x0}, - 933: {region: 0x49, script: 0x55, flags: 0x0}, - 934: {region: 0x165, script: 0x55, flags: 0x0}, - 935: {region: 0x9c, script: 0xe3, flags: 0x0}, - 936: {region: 0x165, script: 0x55, flags: 0x0}, - 937: {region: 0x60, script: 0x55, flags: 0x0}, - 938: {region: 0x165, script: 0x5, flags: 0x0}, - 939: {region: 0xb0, script: 0x84, flags: 0x0}, - 941: {region: 0x165, script: 0x55, flags: 0x0}, - 942: {region: 0x165, script: 0x55, flags: 0x0}, - 943: {region: 0x99, script: 0x12, flags: 0x0}, - 944: {region: 0xa4, script: 0x55, flags: 0x0}, - 945: {region: 0xe9, script: 0x55, flags: 0x0}, - 946: {region: 0x165, script: 0x55, flags: 0x0}, - 947: {region: 0x9e, script: 0x55, flags: 0x0}, - 948: {region: 0x165, script: 0x55, flags: 0x0}, - 949: {region: 0x165, script: 0x55, flags: 0x0}, - 950: {region: 0x87, script: 0x30, flags: 0x0}, - 951: {region: 0x75, script: 0x55, flags: 0x0}, - 952: {region: 0x165, script: 0x55, flags: 0x0}, - 953: {region: 0xe8, script: 0x48, flags: 0x0}, - 954: {region: 0x9c, script: 0x5, flags: 0x0}, - 955: {region: 0x1, script: 0x55, flags: 0x0}, - 956: {region: 0x24, script: 0x5, flags: 0x0}, - 957: {region: 0x165, script: 0x55, flags: 0x0}, - 958: {region: 0x41, script: 0x55, flags: 0x0}, - 959: {region: 0x165, script: 0x55, flags: 0x0}, - 960: {region: 0x7a, script: 0x55, flags: 0x0}, - 961: {region: 0x165, script: 0x55, flags: 0x0}, - 962: {region: 0xe4, script: 0x55, flags: 0x0}, - 963: {region: 0x89, script: 0x55, flags: 0x0}, - 964: {region: 0x69, script: 0x55, flags: 0x0}, - 965: {region: 0x165, script: 0x55, flags: 0x0}, - 966: {region: 0x99, script: 0x20, flags: 0x0}, - 967: {region: 0x165, script: 0x55, flags: 0x0}, - 968: {region: 0x102, script: 0x55, flags: 0x0}, - 969: {region: 0x95, script: 0x55, flags: 0x0}, - 970: {region: 0x165, script: 0x55, flags: 0x0}, - 971: {region: 0x165, script: 0x55, flags: 0x0}, - 972: {region: 0x9e, script: 0x55, flags: 0x0}, - 973: {region: 0x165, script: 0x5, flags: 0x0}, - 974: {region: 0x99, script: 0x55, flags: 0x0}, - 975: {region: 0x31, script: 0x2, flags: 0x1}, - 976: {region: 0xdb, script: 0x20, flags: 0x0}, - 977: {region: 0x35, script: 0xe, flags: 0x0}, - 978: {region: 0x4e, script: 0x55, flags: 0x0}, - 979: {region: 0x72, script: 0x55, flags: 0x0}, - 980: {region: 0x4e, script: 0x55, flags: 0x0}, - 981: {region: 0x9c, script: 0x5, flags: 0x0}, - 982: {region: 0x10c, script: 0x55, flags: 0x0}, - 983: {region: 0x3a, script: 0x55, flags: 0x0}, - 984: {region: 0x165, script: 0x55, flags: 0x0}, - 985: {region: 0xd1, script: 0x55, flags: 0x0}, - 986: {region: 0x104, script: 0x55, flags: 0x0}, - 987: {region: 0x95, script: 0x55, flags: 0x0}, - 988: {region: 0x12f, script: 0x55, flags: 0x0}, - 989: {region: 0x165, script: 0x55, flags: 0x0}, - 990: {region: 0x165, script: 0x55, flags: 0x0}, - 991: {region: 0x73, script: 0x55, flags: 0x0}, - 992: {region: 0x106, script: 0x1e, flags: 0x0}, - 993: {region: 0x130, script: 0x1e, flags: 0x0}, - 994: {region: 0x109, script: 0x55, flags: 0x0}, - 995: {region: 0x107, script: 0x55, flags: 0x0}, - 996: {region: 0x12f, script: 0x55, flags: 0x0}, - 997: {region: 0x165, script: 0x55, flags: 0x0}, - 998: {region: 0xa2, script: 0x47, flags: 0x0}, - 999: {region: 0x99, script: 0x20, flags: 0x0}, - 1000: {region: 0x80, script: 0x55, flags: 0x0}, - 1001: {region: 0x106, script: 0x1e, flags: 0x0}, - 1002: {region: 0xa4, script: 0x55, flags: 0x0}, - 1003: {region: 0x95, script: 0x55, flags: 0x0}, - 1004: {region: 0x99, script: 0x55, flags: 0x0}, - 1005: {region: 0x114, script: 0x55, flags: 0x0}, - 1006: {region: 0x99, script: 0xc0, flags: 0x0}, - 1007: {region: 0x165, script: 0x55, flags: 0x0}, - 1008: {region: 0x165, script: 0x55, flags: 0x0}, - 1009: {region: 0x12f, script: 0x55, flags: 0x0}, - 1010: {region: 0x9e, script: 0x55, flags: 0x0}, - 1011: {region: 0x99, script: 0x20, flags: 0x0}, - 1012: {region: 0x165, script: 0x5, flags: 0x0}, - 1013: {region: 0x9e, script: 0x55, flags: 0x0}, - 1014: {region: 0x7b, script: 0x55, flags: 0x0}, - 1015: {region: 0x49, script: 0x55, flags: 0x0}, - 1016: {region: 0x33, script: 0x4, flags: 0x1}, - 1017: {region: 0x9e, script: 0x55, flags: 0x0}, - 1018: {region: 0x9c, script: 0x5, flags: 0x0}, - 1019: {region: 0xda, script: 0x55, flags: 0x0}, - 1020: {region: 0x4f, script: 0x55, flags: 0x0}, - 1021: {region: 0xd1, script: 0x55, flags: 0x0}, - 1022: {region: 0xcf, script: 0x55, flags: 0x0}, - 1023: {region: 0xc3, script: 0x55, flags: 0x0}, - 1024: {region: 0x4c, script: 0x55, flags: 0x0}, - 1025: {region: 0x96, script: 0x77, flags: 0x0}, - 1026: {region: 0xb6, script: 0x55, flags: 0x0}, - 1027: {region: 0x165, script: 0x28, flags: 0x0}, - 1028: {region: 0x165, script: 0x55, flags: 0x0}, - 1030: {region: 0xba, script: 0xd8, flags: 0x0}, - 1031: {region: 0x165, script: 0x55, flags: 0x0}, - 1032: {region: 0xc4, script: 0x70, flags: 0x0}, - 1033: {region: 0x165, script: 0x5, flags: 0x0}, - 1034: {region: 0xb3, script: 0xc6, flags: 0x0}, - 1035: {region: 0x6f, script: 0x55, flags: 0x0}, - 1036: {region: 0x165, script: 0x55, flags: 0x0}, - 1037: {region: 0x165, script: 0x55, flags: 0x0}, - 1038: {region: 0x165, script: 0x55, flags: 0x0}, - 1039: {region: 0x165, script: 0x55, flags: 0x0}, - 1040: {region: 0x111, script: 0x55, flags: 0x0}, - 1041: {region: 0x165, script: 0x55, flags: 0x0}, - 1042: {region: 0xe8, script: 0x5, flags: 0x0}, - 1043: {region: 0x165, script: 0x55, flags: 0x0}, - 1044: {region: 0x10f, script: 0x55, flags: 0x0}, - 1045: {region: 0x165, script: 0x55, flags: 0x0}, - 1046: {region: 0xe9, script: 0x55, flags: 0x0}, - 1047: {region: 0x165, script: 0x55, flags: 0x0}, - 1048: {region: 0x95, script: 0x55, flags: 0x0}, - 1049: {region: 0x142, script: 0x55, flags: 0x0}, - 1050: {region: 0x10c, script: 0x55, flags: 0x0}, - 1052: {region: 0x10c, script: 0x55, flags: 0x0}, - 1053: {region: 0x72, script: 0x55, flags: 0x0}, - 1054: {region: 0x97, script: 0xbd, flags: 0x0}, - 1055: {region: 0x165, script: 0x55, flags: 0x0}, - 1056: {region: 0x72, script: 0x55, flags: 0x0}, - 1057: {region: 0x164, script: 0x55, flags: 0x0}, - 1058: {region: 0x165, script: 0x55, flags: 0x0}, - 1059: {region: 0xc3, script: 0x55, flags: 0x0}, - 1060: {region: 0x165, script: 0x55, flags: 0x0}, - 1061: {region: 0x165, script: 0x55, flags: 0x0}, - 1062: {region: 0x165, script: 0x55, flags: 0x0}, - 1063: {region: 0x115, script: 0x55, flags: 0x0}, - 1064: {region: 0x165, script: 0x55, flags: 0x0}, - 1065: {region: 0x165, script: 0x55, flags: 0x0}, - 1066: {region: 0x123, script: 0xdb, flags: 0x0}, - 1067: {region: 0x165, script: 0x55, flags: 0x0}, - 1068: {region: 0x165, script: 0x55, flags: 0x0}, - 1069: {region: 0x165, script: 0x55, flags: 0x0}, - 1070: {region: 0x165, script: 0x55, flags: 0x0}, - 1071: {region: 0x27, script: 0x55, flags: 0x0}, - 1072: {region: 0x37, script: 0x5, flags: 0x1}, - 1073: {region: 0x99, script: 0xc7, flags: 0x0}, - 1074: {region: 0x116, script: 0x55, flags: 0x0}, - 1075: {region: 0x114, script: 0x55, flags: 0x0}, - 1076: {region: 0x99, script: 0x20, flags: 0x0}, - 1077: {region: 0x161, script: 0x55, flags: 0x0}, - 1078: {region: 0x165, script: 0x55, flags: 0x0}, - 1079: {region: 0x165, script: 0x55, flags: 0x0}, - 1080: {region: 0x6d, script: 0x55, flags: 0x0}, - 1081: {region: 0x161, script: 0x55, flags: 0x0}, - 1082: {region: 0x165, script: 0x55, flags: 0x0}, - 1083: {region: 0x60, script: 0x55, flags: 0x0}, - 1084: {region: 0x95, script: 0x55, flags: 0x0}, - 1085: {region: 0x165, script: 0x55, flags: 0x0}, - 1086: {region: 0x165, script: 0x55, flags: 0x0}, - 1087: {region: 0x12f, script: 0x55, flags: 0x0}, - 1088: {region: 0x165, script: 0x55, flags: 0x0}, - 1089: {region: 0x84, script: 0x55, flags: 0x0}, - 1090: {region: 0x10c, script: 0x55, flags: 0x0}, - 1091: {region: 0x12f, script: 0x55, flags: 0x0}, - 1092: {region: 0x15f, script: 0x5, flags: 0x0}, - 1093: {region: 0x4b, script: 0x55, flags: 0x0}, - 1094: {region: 0x60, script: 0x55, flags: 0x0}, - 1095: {region: 0x165, script: 0x55, flags: 0x0}, - 1096: {region: 0x99, script: 0x20, flags: 0x0}, - 1097: {region: 0x95, script: 0x55, flags: 0x0}, - 1098: {region: 0x165, script: 0x55, flags: 0x0}, - 1099: {region: 0x35, script: 0xe, flags: 0x0}, - 1100: {region: 0x9b, script: 0xcb, flags: 0x0}, - 1101: {region: 0xe9, script: 0x55, flags: 0x0}, - 1102: {region: 0x99, script: 0xd3, flags: 0x0}, - 1103: {region: 0xdb, script: 0x20, flags: 0x0}, - 1104: {region: 0x165, script: 0x55, flags: 0x0}, - 1105: {region: 0x165, script: 0x55, flags: 0x0}, - 1106: {region: 0x165, script: 0x55, flags: 0x0}, - 1107: {region: 0x165, script: 0x55, flags: 0x0}, - 1108: {region: 0x165, script: 0x55, flags: 0x0}, - 1109: {region: 0x165, script: 0x55, flags: 0x0}, - 1110: {region: 0x165, script: 0x55, flags: 0x0}, - 1111: {region: 0x165, script: 0x55, flags: 0x0}, - 1112: {region: 0xe7, script: 0x55, flags: 0x0}, - 1113: {region: 0x165, script: 0x55, flags: 0x0}, - 1114: {region: 0x165, script: 0x55, flags: 0x0}, - 1115: {region: 0x99, script: 0x4d, flags: 0x0}, - 1116: {region: 0x53, script: 0xd1, flags: 0x0}, - 1117: {region: 0xdb, script: 0x20, flags: 0x0}, - 1118: {region: 0xdb, script: 0x20, flags: 0x0}, - 1119: {region: 0x99, script: 0xd6, flags: 0x0}, - 1120: {region: 0x165, script: 0x55, flags: 0x0}, - 1121: {region: 0x112, script: 0x55, flags: 0x0}, - 1122: {region: 0x131, script: 0x55, flags: 0x0}, - 1123: {region: 0x126, script: 0x55, flags: 0x0}, - 1124: {region: 0x165, script: 0x55, flags: 0x0}, - 1125: {region: 0x3c, script: 0x3, flags: 0x1}, - 1126: {region: 0x165, script: 0x55, flags: 0x0}, - 1127: {region: 0x165, script: 0x55, flags: 0x0}, - 1128: {region: 0x165, script: 0x55, flags: 0x0}, - 1129: {region: 0x123, script: 0xdb, flags: 0x0}, - 1130: {region: 0xdb, script: 0x20, flags: 0x0}, - 1131: {region: 0xdb, script: 0x20, flags: 0x0}, - 1132: {region: 0xdb, script: 0x20, flags: 0x0}, - 1133: {region: 0x6f, script: 0x28, flags: 0x0}, - 1134: {region: 0x165, script: 0x55, flags: 0x0}, - 1135: {region: 0x6d, script: 0x28, flags: 0x0}, - 1136: {region: 0x165, script: 0x55, flags: 0x0}, - 1137: {region: 0x165, script: 0x55, flags: 0x0}, - 1138: {region: 0x165, script: 0x55, flags: 0x0}, - 1139: {region: 0xd6, script: 0x55, flags: 0x0}, - 1140: {region: 0x127, script: 0x55, flags: 0x0}, - 1141: {region: 0x125, script: 0x55, flags: 0x0}, - 1142: {region: 0x32, script: 0x55, flags: 0x0}, - 1143: {region: 0xdb, script: 0x20, flags: 0x0}, - 1144: {region: 0xe7, script: 0x55, flags: 0x0}, - 1145: {region: 0x165, script: 0x55, flags: 0x0}, - 1146: {region: 0x165, script: 0x55, flags: 0x0}, - 1147: {region: 0x32, script: 0x55, flags: 0x0}, - 1148: {region: 0xd4, script: 0x55, flags: 0x0}, - 1149: {region: 0x165, script: 0x55, flags: 0x0}, - 1150: {region: 0x161, script: 0x55, flags: 0x0}, - 1151: {region: 0x165, script: 0x55, flags: 0x0}, - 1152: {region: 0x129, script: 0x55, flags: 0x0}, - 1153: {region: 0x165, script: 0x55, flags: 0x0}, - 1154: {region: 0xce, script: 0x55, flags: 0x0}, - 1155: {region: 0x165, script: 0x55, flags: 0x0}, - 1156: {region: 0xe6, script: 0x55, flags: 0x0}, - 1157: {region: 0x165, script: 0x55, flags: 0x0}, - 1158: {region: 0x165, script: 0x55, flags: 0x0}, - 1159: {region: 0x165, script: 0x55, flags: 0x0}, - 1160: {region: 0x12b, script: 0x55, flags: 0x0}, - 1161: {region: 0x12b, script: 0x55, flags: 0x0}, - 1162: {region: 0x12e, script: 0x55, flags: 0x0}, - 1163: {region: 0x165, script: 0x5, flags: 0x0}, - 1164: {region: 0x161, script: 0x55, flags: 0x0}, - 1165: {region: 0x87, script: 0x30, flags: 0x0}, - 1166: {region: 0xdb, script: 0x20, flags: 0x0}, - 1167: {region: 0xe7, script: 0x55, flags: 0x0}, - 1168: {region: 0x43, script: 0xdc, flags: 0x0}, - 1169: {region: 0x165, script: 0x55, flags: 0x0}, - 1170: {region: 0x106, script: 0x1e, flags: 0x0}, - 1171: {region: 0x165, script: 0x55, flags: 0x0}, - 1172: {region: 0x165, script: 0x55, flags: 0x0}, - 1173: {region: 0x131, script: 0x55, flags: 0x0}, - 1174: {region: 0x165, script: 0x55, flags: 0x0}, - 1175: {region: 0x123, script: 0xdb, flags: 0x0}, - 1176: {region: 0x32, script: 0x55, flags: 0x0}, - 1177: {region: 0x165, script: 0x55, flags: 0x0}, - 1178: {region: 0x165, script: 0x55, flags: 0x0}, - 1179: {region: 0xce, script: 0x55, flags: 0x0}, - 1180: {region: 0x165, script: 0x55, flags: 0x0}, - 1181: {region: 0x165, script: 0x55, flags: 0x0}, - 1182: {region: 0x12d, script: 0x55, flags: 0x0}, - 1183: {region: 0x165, script: 0x55, flags: 0x0}, - 1185: {region: 0x165, script: 0x55, flags: 0x0}, - 1186: {region: 0xd4, script: 0x55, flags: 0x0}, - 1187: {region: 0x53, script: 0xd4, flags: 0x0}, - 1188: {region: 0xe5, script: 0x55, flags: 0x0}, - 1189: {region: 0x165, script: 0x55, flags: 0x0}, - 1190: {region: 0x106, script: 0x1e, flags: 0x0}, - 1191: {region: 0xba, script: 0x55, flags: 0x0}, - 1192: {region: 0x165, script: 0x55, flags: 0x0}, - 1193: {region: 0x106, script: 0x1e, flags: 0x0}, - 1194: {region: 0x3f, script: 0x4, flags: 0x1}, - 1195: {region: 0x11c, script: 0xde, flags: 0x0}, - 1196: {region: 0x130, script: 0x1e, flags: 0x0}, - 1197: {region: 0x75, script: 0x55, flags: 0x0}, - 1198: {region: 0x2a, script: 0x55, flags: 0x0}, - 1200: {region: 0x43, script: 0x3, flags: 0x1}, - 1201: {region: 0x99, script: 0xe, flags: 0x0}, - 1202: {region: 0xe8, script: 0x5, flags: 0x0}, - 1203: {region: 0x165, script: 0x55, flags: 0x0}, - 1204: {region: 0x165, script: 0x55, flags: 0x0}, - 1205: {region: 0x165, script: 0x55, flags: 0x0}, - 1206: {region: 0x165, script: 0x55, flags: 0x0}, - 1207: {region: 0x165, script: 0x55, flags: 0x0}, - 1208: {region: 0x165, script: 0x55, flags: 0x0}, - 1209: {region: 0x165, script: 0x55, flags: 0x0}, - 1210: {region: 0x46, script: 0x4, flags: 0x1}, - 1211: {region: 0x165, script: 0x55, flags: 0x0}, - 1212: {region: 0xb4, script: 0xdf, flags: 0x0}, - 1213: {region: 0x165, script: 0x55, flags: 0x0}, - 1214: {region: 0x161, script: 0x55, flags: 0x0}, - 1215: {region: 0x9e, script: 0x55, flags: 0x0}, - 1216: {region: 0x106, script: 0x55, flags: 0x0}, - 1217: {region: 0x13e, script: 0x55, flags: 0x0}, - 1218: {region: 0x11b, script: 0x55, flags: 0x0}, - 1219: {region: 0x165, script: 0x55, flags: 0x0}, - 1220: {region: 0x36, script: 0x55, flags: 0x0}, - 1221: {region: 0x60, script: 0x55, flags: 0x0}, - 1222: {region: 0xd1, script: 0x55, flags: 0x0}, - 1223: {region: 0x1, script: 0x55, flags: 0x0}, - 1224: {region: 0x106, script: 0x55, flags: 0x0}, - 1225: {region: 0x6a, script: 0x55, flags: 0x0}, - 1226: {region: 0x12f, script: 0x55, flags: 0x0}, - 1227: {region: 0x165, script: 0x55, flags: 0x0}, - 1228: {region: 0x36, script: 0x55, flags: 0x0}, - 1229: {region: 0x4e, script: 0x55, flags: 0x0}, - 1230: {region: 0x165, script: 0x55, flags: 0x0}, - 1231: {region: 0x6f, script: 0x28, flags: 0x0}, - 1232: {region: 0x165, script: 0x55, flags: 0x0}, - 1233: {region: 0xe7, script: 0x55, flags: 0x0}, - 1234: {region: 0x2f, script: 0x55, flags: 0x0}, - 1235: {region: 0x99, script: 0xd6, flags: 0x0}, - 1236: {region: 0x99, script: 0x20, flags: 0x0}, - 1237: {region: 0x165, script: 0x55, flags: 0x0}, - 1238: {region: 0x165, script: 0x55, flags: 0x0}, - 1239: {region: 0x165, script: 0x55, flags: 0x0}, - 1240: {region: 0x165, script: 0x55, flags: 0x0}, - 1241: {region: 0x165, script: 0x55, flags: 0x0}, - 1242: {region: 0x165, script: 0x55, flags: 0x0}, - 1243: {region: 0x165, script: 0x55, flags: 0x0}, - 1244: {region: 0x165, script: 0x55, flags: 0x0}, - 1245: {region: 0x165, script: 0x55, flags: 0x0}, - 1246: {region: 0x140, script: 0x55, flags: 0x0}, - 1247: {region: 0x165, script: 0x55, flags: 0x0}, - 1248: {region: 0x165, script: 0x55, flags: 0x0}, - 1249: {region: 0xa8, script: 0x5, flags: 0x0}, - 1250: {region: 0x165, script: 0x55, flags: 0x0}, - 1251: {region: 0x114, script: 0x55, flags: 0x0}, - 1252: {region: 0x165, script: 0x55, flags: 0x0}, - 1253: {region: 0x165, script: 0x55, flags: 0x0}, - 1254: {region: 0x165, script: 0x55, flags: 0x0}, - 1255: {region: 0x165, script: 0x55, flags: 0x0}, - 1256: {region: 0x99, script: 0x20, flags: 0x0}, - 1257: {region: 0x53, script: 0x37, flags: 0x0}, - 1258: {region: 0x165, script: 0x55, flags: 0x0}, - 1259: {region: 0x165, script: 0x55, flags: 0x0}, - 1260: {region: 0x41, script: 0x55, flags: 0x0}, - 1261: {region: 0x165, script: 0x55, flags: 0x0}, - 1262: {region: 0x12b, script: 0x18, flags: 0x0}, - 1263: {region: 0x165, script: 0x55, flags: 0x0}, - 1264: {region: 0x161, script: 0x55, flags: 0x0}, - 1265: {region: 0x165, script: 0x55, flags: 0x0}, - 1266: {region: 0x12b, script: 0x5d, flags: 0x0}, - 1267: {region: 0x12b, script: 0x5e, flags: 0x0}, - 1268: {region: 0x7d, script: 0x2a, flags: 0x0}, - 1269: {region: 0x53, script: 0x62, flags: 0x0}, - 1270: {region: 0x10b, script: 0x67, flags: 0x0}, - 1271: {region: 0x108, script: 0x71, flags: 0x0}, - 1272: {region: 0x99, script: 0x20, flags: 0x0}, - 1273: {region: 0x131, script: 0x55, flags: 0x0}, - 1274: {region: 0x165, script: 0x55, flags: 0x0}, - 1275: {region: 0x9c, script: 0x87, flags: 0x0}, - 1276: {region: 0x165, script: 0x55, flags: 0x0}, - 1277: {region: 0x15e, script: 0xbf, flags: 0x0}, - 1278: {region: 0x165, script: 0x55, flags: 0x0}, - 1279: {region: 0x165, script: 0x55, flags: 0x0}, - 1280: {region: 0xdb, script: 0x20, flags: 0x0}, - 1281: {region: 0x165, script: 0x55, flags: 0x0}, - 1282: {region: 0x165, script: 0x55, flags: 0x0}, - 1283: {region: 0xd1, script: 0x55, flags: 0x0}, - 1284: {region: 0x75, script: 0x55, flags: 0x0}, - 1285: {region: 0x165, script: 0x55, flags: 0x0}, - 1286: {region: 0x165, script: 0x55, flags: 0x0}, - 1287: {region: 0x52, script: 0x55, flags: 0x0}, - 1288: {region: 0x165, script: 0x55, flags: 0x0}, - 1289: {region: 0x165, script: 0x55, flags: 0x0}, - 1290: {region: 0x165, script: 0x55, flags: 0x0}, - 1291: {region: 0x52, script: 0x55, flags: 0x0}, - 1292: {region: 0x165, script: 0x55, flags: 0x0}, - 1293: {region: 0x165, script: 0x55, flags: 0x0}, - 1294: {region: 0x165, script: 0x55, flags: 0x0}, - 1295: {region: 0x165, script: 0x55, flags: 0x0}, - 1296: {region: 0x1, script: 0x3a, flags: 0x0}, - 1297: {region: 0x165, script: 0x55, flags: 0x0}, - 1298: {region: 0x165, script: 0x55, flags: 0x0}, - 1299: {region: 0x165, script: 0x55, flags: 0x0}, - 1300: {region: 0x165, script: 0x55, flags: 0x0}, - 1301: {region: 0x165, script: 0x55, flags: 0x0}, - 1302: {region: 0xd6, script: 0x55, flags: 0x0}, - 1303: {region: 0x165, script: 0x55, flags: 0x0}, - 1304: {region: 0x165, script: 0x55, flags: 0x0}, - 1305: {region: 0x165, script: 0x55, flags: 0x0}, - 1306: {region: 0x41, script: 0x55, flags: 0x0}, - 1307: {region: 0x165, script: 0x55, flags: 0x0}, - 1308: {region: 0xcf, script: 0x55, flags: 0x0}, - 1309: {region: 0x4a, script: 0x3, flags: 0x1}, - 1310: {region: 0x165, script: 0x55, flags: 0x0}, - 1311: {region: 0x165, script: 0x55, flags: 0x0}, - 1312: {region: 0x165, script: 0x55, flags: 0x0}, - 1313: {region: 0x53, script: 0x55, flags: 0x0}, - 1314: {region: 0x10b, script: 0x55, flags: 0x0}, - 1316: {region: 0xa8, script: 0x5, flags: 0x0}, - 1317: {region: 0xd9, script: 0x55, flags: 0x0}, - 1318: {region: 0xba, script: 0xd8, flags: 0x0}, - 1319: {region: 0x4d, script: 0x14, flags: 0x1}, - 1320: {region: 0x165, script: 0x55, flags: 0x0}, - 1321: {region: 0x122, script: 0x55, flags: 0x0}, - 1322: {region: 0xd0, script: 0x55, flags: 0x0}, - 1323: {region: 0x165, script: 0x55, flags: 0x0}, - 1324: {region: 0x161, script: 0x55, flags: 0x0}, - 1326: {region: 0x12b, script: 0x55, flags: 0x0}, -} - -// likelyLangList holds lists info associated with likelyLang. -// Size: 388 bytes, 97 elements -var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x72, flags: 0x2}, - 2: {region: 0x11c, script: 0x7d, flags: 0x2}, - 3: {region: 0x32, script: 0x55, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x1e, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x1e, flags: 0x0}, - 9: {region: 0x38, script: 0x2b, flags: 0x2}, - 10: {region: 0x135, script: 0x55, flags: 0x0}, - 11: {region: 0x7b, script: 0xc2, flags: 0x2}, - 12: {region: 0x114, script: 0x55, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1d, flags: 0x0}, - 15: {region: 0x87, script: 0x5a, flags: 0x2}, - 16: {region: 0xd6, script: 0x55, flags: 0x0}, - 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x1e, flags: 0x0}, - 20: {region: 0x24, script: 0x5, flags: 0x4}, - 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, - 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x55, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x1e, flags: 0x0}, - 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x55, flags: 0x4}, - 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x55, flags: 0x2}, - 33: {region: 0xdb, script: 0x20, flags: 0x0}, - 34: {region: 0x99, script: 0x58, flags: 0x2}, - 35: {region: 0x83, script: 0x55, flags: 0x0}, - 36: {region: 0x84, script: 0x75, flags: 0x4}, - 37: {region: 0x84, script: 0x75, flags: 0x2}, - 38: {region: 0xc5, script: 0x1e, flags: 0x0}, - 39: {region: 0x53, script: 0x6b, flags: 0x4}, - 40: {region: 0x53, script: 0x6b, flags: 0x2}, - 41: {region: 0xd0, script: 0x55, flags: 0x0}, - 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x32, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x81, flags: 0x0}, - 48: {region: 0x53, script: 0x82, flags: 0x2}, - 49: {region: 0xba, script: 0xd8, flags: 0x0}, - 50: {region: 0xd9, script: 0x55, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x20, flags: 0x2}, - 53: {region: 0x99, script: 0x4a, flags: 0x2}, - 54: {region: 0x99, script: 0xc5, flags: 0x2}, - 55: {region: 0x105, script: 0x1e, flags: 0x0}, - 56: {region: 0xbd, script: 0x55, flags: 0x4}, - 57: {region: 0x104, script: 0x55, flags: 0x4}, - 58: {region: 0x106, script: 0x55, flags: 0x4}, - 59: {region: 0x12b, script: 0x55, flags: 0x4}, - 60: {region: 0x124, script: 0x1e, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, - 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x1e, flags: 0x4}, - 65: {region: 0xc5, script: 0x1e, flags: 0x4}, - 66: {region: 0xae, script: 0x1e, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x20, flags: 0x4}, - 69: {region: 0xdb, script: 0x20, flags: 0x2}, - 70: {region: 0x137, script: 0x55, flags: 0x0}, - 71: {region: 0x24, script: 0x5, flags: 0x4}, - 72: {region: 0x53, script: 0x1e, flags: 0x4}, - 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x38, flags: 0x0}, - 75: {region: 0x53, script: 0x37, flags: 0x4}, - 76: {region: 0x53, script: 0x37, flags: 0x2}, - 77: {region: 0x53, script: 0x37, flags: 0x0}, - 78: {region: 0x2f, script: 0x38, flags: 0x4}, - 79: {region: 0x3e, script: 0x38, flags: 0x4}, - 80: {region: 0x7b, script: 0x38, flags: 0x4}, - 81: {region: 0x7e, script: 0x38, flags: 0x4}, - 82: {region: 0x8d, script: 0x38, flags: 0x4}, - 83: {region: 0x95, script: 0x38, flags: 0x4}, - 84: {region: 0xc6, script: 0x38, flags: 0x4}, - 85: {region: 0xd0, script: 0x38, flags: 0x4}, - 86: {region: 0xe2, script: 0x38, flags: 0x4}, - 87: {region: 0xe5, script: 0x38, flags: 0x4}, - 88: {region: 0xe7, script: 0x38, flags: 0x4}, - 89: {region: 0x116, script: 0x38, flags: 0x4}, - 90: {region: 0x123, script: 0x38, flags: 0x4}, - 91: {region: 0x12e, script: 0x38, flags: 0x4}, - 92: {region: 0x135, script: 0x38, flags: 0x4}, - 93: {region: 0x13e, script: 0x38, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x33, flags: 0x2}, - 96: {region: 0x12e, script: 0x38, flags: 0x2}, -} - -type likelyLangScript struct { - lang uint16 - script uint8 - flags uint8 -} - -// likelyRegion is a lookup table, indexed by regionID, for the most likely -// languages and scripts given incomplete information. If more entries exist -// for a given regionID, lang and script are the index and size respectively -// of the list in likelyRegionList. -// TODO: exclude containers and user-definable regions from the list. -// Size: 1432 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x55, flags: 0x0}, - 35: {lang: 0x3a, script: 0x5, flags: 0x0}, - 36: {lang: 0x0, script: 0x2, flags: 0x1}, - 39: {lang: 0x2, script: 0x2, flags: 0x1}, - 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3be, script: 0x55, flags: 0x0}, - 43: {lang: 0x0, script: 0x55, flags: 0x0}, - 44: {lang: 0x13d, script: 0x55, flags: 0x0}, - 45: {lang: 0x419, script: 0x55, flags: 0x0}, - 46: {lang: 0x10c, script: 0x55, flags: 0x0}, - 48: {lang: 0x365, script: 0x55, flags: 0x0}, - 49: {lang: 0x442, script: 0x55, flags: 0x0}, - 50: {lang: 0x58, script: 0x55, flags: 0x0}, - 51: {lang: 0x6, script: 0x2, flags: 0x1}, - 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x365, script: 0x55, flags: 0x0}, - 55: {lang: 0x15d, script: 0x55, flags: 0x0}, - 56: {lang: 0x7e, script: 0x1e, flags: 0x0}, - 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d7, script: 0x55, flags: 0x0}, - 59: {lang: 0x15d, script: 0x55, flags: 0x0}, - 60: {lang: 0x15d, script: 0x55, flags: 0x0}, - 62: {lang: 0x31d, script: 0x55, flags: 0x0}, - 63: {lang: 0x13d, script: 0x55, flags: 0x0}, - 64: {lang: 0x39f, script: 0x55, flags: 0x0}, - 65: {lang: 0x3be, script: 0x55, flags: 0x0}, - 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x55, flags: 0x0}, - 71: {lang: 0x71, script: 0x1e, flags: 0x0}, - 73: {lang: 0x510, script: 0x3a, flags: 0x2}, - 74: {lang: 0x31d, script: 0x5, flags: 0x2}, - 75: {lang: 0x443, script: 0x55, flags: 0x0}, - 76: {lang: 0x15d, script: 0x55, flags: 0x0}, - 77: {lang: 0x15d, script: 0x55, flags: 0x0}, - 78: {lang: 0x10c, script: 0x55, flags: 0x0}, - 79: {lang: 0x15d, script: 0x55, flags: 0x0}, - 81: {lang: 0x13d, script: 0x55, flags: 0x0}, - 82: {lang: 0x15d, script: 0x55, flags: 0x0}, - 83: {lang: 0xa, script: 0x5, flags: 0x1}, - 84: {lang: 0x13d, script: 0x55, flags: 0x0}, - 85: {lang: 0x0, script: 0x55, flags: 0x0}, - 86: {lang: 0x13d, script: 0x55, flags: 0x0}, - 89: {lang: 0x13d, script: 0x55, flags: 0x0}, - 90: {lang: 0x3be, script: 0x55, flags: 0x0}, - 91: {lang: 0x39f, script: 0x55, flags: 0x0}, - 93: {lang: 0xf, script: 0x2, flags: 0x1}, - 94: {lang: 0xf9, script: 0x55, flags: 0x0}, - 96: {lang: 0x10c, script: 0x55, flags: 0x0}, - 98: {lang: 0x1, script: 0x55, flags: 0x0}, - 99: {lang: 0x100, script: 0x55, flags: 0x0}, - 101: {lang: 0x13d, script: 0x55, flags: 0x0}, - 103: {lang: 0x11, script: 0x2, flags: 0x1}, - 104: {lang: 0x13d, script: 0x55, flags: 0x0}, - 105: {lang: 0x13d, script: 0x55, flags: 0x0}, - 106: {lang: 0x13f, script: 0x55, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, - 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46d, script: 0x28, flags: 0x0}, - 110: {lang: 0x13d, script: 0x55, flags: 0x0}, - 111: {lang: 0x13, script: 0x2, flags: 0x1}, - 113: {lang: 0x10c, script: 0x55, flags: 0x0}, - 114: {lang: 0x150, script: 0x55, flags: 0x0}, - 115: {lang: 0x1be, script: 0x20, flags: 0x2}, - 118: {lang: 0x157, script: 0x55, flags: 0x0}, - 120: {lang: 0x15d, script: 0x55, flags: 0x0}, - 122: {lang: 0x15d, script: 0x55, flags: 0x0}, - 123: {lang: 0x15, script: 0x2, flags: 0x1}, - 125: {lang: 0x17, script: 0x3, flags: 0x1}, - 126: {lang: 0x15d, script: 0x55, flags: 0x0}, - 128: {lang: 0x21, script: 0x55, flags: 0x0}, - 130: {lang: 0x243, script: 0x55, flags: 0x0}, - 132: {lang: 0x15d, script: 0x55, flags: 0x0}, - 133: {lang: 0x15d, script: 0x55, flags: 0x0}, - 134: {lang: 0x13d, script: 0x55, flags: 0x0}, - 135: {lang: 0x1a, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x55, flags: 0x0}, - 137: {lang: 0x13d, script: 0x55, flags: 0x0}, - 139: {lang: 0x3be, script: 0x55, flags: 0x0}, - 141: {lang: 0x527, script: 0x38, flags: 0x0}, - 142: {lang: 0x0, script: 0x55, flags: 0x0}, - 143: {lang: 0x13d, script: 0x55, flags: 0x0}, - 144: {lang: 0x1cf, script: 0x55, flags: 0x0}, - 145: {lang: 0x1d2, script: 0x55, flags: 0x0}, - 146: {lang: 0x1d3, script: 0x55, flags: 0x0}, - 148: {lang: 0x13d, script: 0x55, flags: 0x0}, - 149: {lang: 0x1c, script: 0x2, flags: 0x1}, - 151: {lang: 0x1ba, script: 0x3a, flags: 0x0}, - 153: {lang: 0x1e, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x21, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f6, script: 0x55, flags: 0x0}, - 158: {lang: 0x1f7, script: 0x55, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x1fe, script: 0x44, flags: 0x0}, - 164: {lang: 0x443, script: 0x55, flags: 0x0}, - 165: {lang: 0x288, script: 0x1e, flags: 0x0}, - 166: {lang: 0x23, script: 0x3, flags: 0x1}, - 168: {lang: 0x26, script: 0x2, flags: 0x1}, - 170: {lang: 0x252, script: 0x4e, flags: 0x0}, - 171: {lang: 0x252, script: 0x4e, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e0, script: 0x1e, flags: 0x0}, - 175: {lang: 0x28, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10c, script: 0x55, flags: 0x0}, - 179: {lang: 0x40a, script: 0xc6, flags: 0x0}, - 181: {lang: 0x439, script: 0x55, flags: 0x0}, - 182: {lang: 0x2be, script: 0x55, flags: 0x0}, - 183: {lang: 0x15d, script: 0x55, flags: 0x0}, - 184: {lang: 0x2c5, script: 0x55, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x2a, script: 0x2, flags: 0x1}, - 187: {lang: 0x15d, script: 0x55, flags: 0x0}, - 188: {lang: 0x2c, script: 0x2, flags: 0x1}, - 189: {lang: 0x430, script: 0x55, flags: 0x0}, - 190: {lang: 0x15d, script: 0x55, flags: 0x0}, - 191: {lang: 0x2ef, script: 0x55, flags: 0x0}, - 194: {lang: 0x2e, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x55, flags: 0x0}, - 196: {lang: 0x30, script: 0x2, flags: 0x1}, - 197: {lang: 0x32, script: 0x2, flags: 0x1}, - 198: {lang: 0x34, script: 0x2, flags: 0x1}, - 200: {lang: 0x15d, script: 0x55, flags: 0x0}, - 201: {lang: 0x36, script: 0x2, flags: 0x1}, - 203: {lang: 0x31e, script: 0x55, flags: 0x0}, - 204: {lang: 0x38, script: 0x3, flags: 0x1}, - 205: {lang: 0x127, script: 0xda, flags: 0x0}, - 207: {lang: 0x13d, script: 0x55, flags: 0x0}, - 208: {lang: 0x31d, script: 0x55, flags: 0x0}, - 209: {lang: 0x3be, script: 0x55, flags: 0x0}, - 210: {lang: 0x16, script: 0x55, flags: 0x0}, - 211: {lang: 0x15d, script: 0x55, flags: 0x0}, - 212: {lang: 0x1b2, script: 0x55, flags: 0x0}, - 214: {lang: 0x1b2, script: 0x5, flags: 0x2}, - 216: {lang: 0x13d, script: 0x55, flags: 0x0}, - 217: {lang: 0x365, script: 0x55, flags: 0x0}, - 218: {lang: 0x345, script: 0x55, flags: 0x0}, - 219: {lang: 0x34f, script: 0x20, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13d, script: 0x55, flags: 0x0}, - 228: {lang: 0x13d, script: 0x55, flags: 0x0}, - 229: {lang: 0x15d, script: 0x55, flags: 0x0}, - 230: {lang: 0x484, script: 0x55, flags: 0x0}, - 231: {lang: 0x152, script: 0x55, flags: 0x0}, - 232: {lang: 0x3b, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b1, script: 0x55, flags: 0x0}, - 234: {lang: 0x15d, script: 0x55, flags: 0x0}, - 236: {lang: 0x13d, script: 0x55, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3be, script: 0x55, flags: 0x0}, - 240: {lang: 0x3a0, script: 0x55, flags: 0x0}, - 241: {lang: 0x192, script: 0x55, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15d, script: 0x55, flags: 0x0}, - 260: {lang: 0x3e, script: 0x2, flags: 0x1}, - 261: {lang: 0x430, script: 0x1e, flags: 0x0}, - 262: {lang: 0x40, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e3, script: 0x55, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15d, script: 0x55, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x42, script: 0x2, flags: 0x1}, - 271: {lang: 0x414, script: 0x55, flags: 0x0}, - 272: {lang: 0x345, script: 0x55, flags: 0x0}, - 273: {lang: 0x44, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f7, script: 0x55, flags: 0x0}, - 276: {lang: 0x15d, script: 0x55, flags: 0x0}, - 277: {lang: 0x427, script: 0x55, flags: 0x0}, - 278: {lang: 0x365, script: 0x55, flags: 0x0}, - 280: {lang: 0x3be, script: 0x55, flags: 0x0}, - 282: {lang: 0x13d, script: 0x55, flags: 0x0}, - 284: {lang: 0x46, script: 0x2, flags: 0x1}, - 288: {lang: 0x15d, script: 0x55, flags: 0x0}, - 289: {lang: 0x15d, script: 0x55, flags: 0x0}, - 290: {lang: 0x48, script: 0x2, flags: 0x1}, - 291: {lang: 0x4a, script: 0x3, flags: 0x1}, - 292: {lang: 0x4d, script: 0x2, flags: 0x1}, - 293: {lang: 0x475, script: 0x55, flags: 0x0}, - 294: {lang: 0x3be, script: 0x55, flags: 0x0}, - 295: {lang: 0x474, script: 0x55, flags: 0x0}, - 296: {lang: 0x4f, script: 0x2, flags: 0x1}, - 297: {lang: 0x480, script: 0x55, flags: 0x0}, - 299: {lang: 0x51, script: 0x4, flags: 0x1}, - 301: {lang: 0x49e, script: 0x55, flags: 0x0}, - 302: {lang: 0x55, script: 0x2, flags: 0x1}, - 303: {lang: 0x443, script: 0x55, flags: 0x0}, - 304: {lang: 0x57, script: 0x3, flags: 0x1}, - 305: {lang: 0x443, script: 0x55, flags: 0x0}, - 309: {lang: 0x510, script: 0x3a, flags: 0x2}, - 310: {lang: 0x13d, script: 0x55, flags: 0x0}, - 311: {lang: 0x4ba, script: 0x55, flags: 0x0}, - 312: {lang: 0x1f7, script: 0x55, flags: 0x0}, - 315: {lang: 0x13d, script: 0x55, flags: 0x0}, - 318: {lang: 0x4c1, script: 0x55, flags: 0x0}, - 319: {lang: 0x8a, script: 0x55, flags: 0x0}, - 320: {lang: 0x15d, script: 0x55, flags: 0x0}, - 322: {lang: 0x419, script: 0x55, flags: 0x0}, - 333: {lang: 0x5a, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5c, script: 0x2, flags: 0x1}, - 356: {lang: 0x421, script: 0x55, flags: 0x0}, -} - -// likelyRegionList holds lists info associated with likelyRegion. -// Size: 376 bytes, 94 elements -var likelyRegionList = [94]likelyLangScript{ - 0: {lang: 0x147, script: 0x5, flags: 0x0}, - 1: {lang: 0x474, script: 0x55, flags: 0x0}, - 2: {lang: 0x42f, script: 0x55, flags: 0x0}, - 3: {lang: 0x2fd, script: 0x1e, flags: 0x0}, - 4: {lang: 0x1d5, script: 0x8, flags: 0x0}, - 5: {lang: 0x272, script: 0x55, flags: 0x0}, - 6: {lang: 0xb7, script: 0x55, flags: 0x0}, - 7: {lang: 0x430, script: 0x1e, flags: 0x0}, - 8: {lang: 0x12c, script: 0xdc, flags: 0x0}, - 9: {lang: 0x34f, script: 0x20, flags: 0x0}, - 10: {lang: 0x527, script: 0x37, flags: 0x0}, - 11: {lang: 0x4aa, script: 0x5, flags: 0x0}, - 12: {lang: 0x51d, script: 0x38, flags: 0x0}, - 13: {lang: 0x521, script: 0x55, flags: 0x0}, - 14: {lang: 0x298, script: 0xdb, flags: 0x0}, - 15: {lang: 0x135, script: 0x30, flags: 0x0}, - 16: {lang: 0x488, script: 0x55, flags: 0x0}, - 17: {lang: 0x3a, script: 0x5, flags: 0x0}, - 18: {lang: 0x15d, script: 0x55, flags: 0x0}, - 19: {lang: 0x27, script: 0x28, flags: 0x0}, - 20: {lang: 0x138, script: 0x55, flags: 0x0}, - 21: {lang: 0x268, script: 0x5, flags: 0x2}, - 22: {lang: 0x510, script: 0x3a, flags: 0x2}, - 23: {lang: 0x20e, script: 0x2a, flags: 0x0}, - 24: {lang: 0x5, script: 0x1e, flags: 0x0}, - 25: {lang: 0x272, script: 0x55, flags: 0x0}, - 26: {lang: 0x135, script: 0x30, flags: 0x0}, - 27: {lang: 0x2fd, script: 0x1e, flags: 0x0}, - 28: {lang: 0x1df, script: 0x55, flags: 0x0}, - 29: {lang: 0x31d, script: 0x5, flags: 0x0}, - 30: {lang: 0x1bc, script: 0x20, flags: 0x0}, - 31: {lang: 0x4b2, script: 0x5, flags: 0x0}, - 32: {lang: 0x234, script: 0x70, flags: 0x0}, - 33: {lang: 0x147, script: 0x5, flags: 0x0}, - 34: {lang: 0x474, script: 0x55, flags: 0x0}, - 35: {lang: 0x248, script: 0x49, flags: 0x0}, - 36: {lang: 0xe6, script: 0x5, flags: 0x0}, - 37: {lang: 0x224, script: 0xdb, flags: 0x0}, - 38: {lang: 0x3a, script: 0x5, flags: 0x0}, - 39: {lang: 0x15d, script: 0x55, flags: 0x0}, - 40: {lang: 0x2b6, script: 0x52, flags: 0x0}, - 41: {lang: 0x224, script: 0xdb, flags: 0x0}, - 42: {lang: 0x3a, script: 0x5, flags: 0x0}, - 43: {lang: 0x15d, script: 0x55, flags: 0x0}, - 44: {lang: 0x3da, script: 0x55, flags: 0x0}, - 45: {lang: 0x4ac, script: 0x1e, flags: 0x0}, - 46: {lang: 0x2fd, script: 0x1e, flags: 0x0}, - 47: {lang: 0x42f, script: 0x55, flags: 0x0}, - 48: {lang: 0x32f, script: 0x70, flags: 0x0}, - 49: {lang: 0x211, script: 0x55, flags: 0x0}, - 50: {lang: 0x309, script: 0x1e, flags: 0x0}, - 51: {lang: 0x240, script: 0x5, flags: 0x0}, - 52: {lang: 0x527, script: 0x38, flags: 0x0}, - 53: {lang: 0x3be, script: 0x55, flags: 0x0}, - 54: {lang: 0x3a, script: 0x5, flags: 0x0}, - 55: {lang: 0x15d, script: 0x55, flags: 0x0}, - 56: {lang: 0x2eb, script: 0x55, flags: 0x0}, - 57: {lang: 0x4b2, script: 0x5, flags: 0x0}, - 58: {lang: 0x88, script: 0x20, flags: 0x0}, - 59: {lang: 0x4b2, script: 0x5, flags: 0x0}, - 60: {lang: 0x4b2, script: 0x5, flags: 0x0}, - 61: {lang: 0xbe, script: 0x20, flags: 0x0}, - 62: {lang: 0x3da, script: 0x55, flags: 0x0}, - 63: {lang: 0x7e, script: 0x1e, flags: 0x0}, - 64: {lang: 0x3e0, script: 0x1e, flags: 0x0}, - 65: {lang: 0x265, script: 0x55, flags: 0x0}, - 66: {lang: 0x442, script: 0x55, flags: 0x0}, - 67: {lang: 0x510, script: 0x3a, flags: 0x0}, - 68: {lang: 0x410, script: 0x55, flags: 0x0}, - 69: {lang: 0x4ac, script: 0x1e, flags: 0x0}, - 70: {lang: 0x3a, script: 0x5, flags: 0x0}, - 71: {lang: 0x15d, script: 0x55, flags: 0x0}, - 72: {lang: 0x15d, script: 0x55, flags: 0x0}, - 73: {lang: 0x35, script: 0x5, flags: 0x0}, - 74: {lang: 0x469, script: 0xdb, flags: 0x0}, - 75: {lang: 0x2ea, script: 0x5, flags: 0x0}, - 76: {lang: 0x30d, script: 0x70, flags: 0x0}, - 77: {lang: 0x465, script: 0x1e, flags: 0x0}, - 78: {lang: 0x147, script: 0x5, flags: 0x0}, - 79: {lang: 0x3a, script: 0x5, flags: 0x0}, - 80: {lang: 0x15d, script: 0x55, flags: 0x0}, - 81: {lang: 0x488, script: 0x55, flags: 0x0}, - 82: {lang: 0x58, script: 0x5, flags: 0x0}, - 83: {lang: 0x217, script: 0x1e, flags: 0x0}, - 84: {lang: 0x81, script: 0x30, flags: 0x0}, - 85: {lang: 0x527, script: 0x38, flags: 0x0}, - 86: {lang: 0x48a, script: 0x55, flags: 0x0}, - 87: {lang: 0x4ac, script: 0x1e, flags: 0x0}, - 88: {lang: 0x510, script: 0x3a, flags: 0x0}, - 89: {lang: 0x3b1, script: 0x55, flags: 0x0}, - 90: {lang: 0x42f, script: 0x55, flags: 0x0}, - 91: {lang: 0x430, script: 0x1e, flags: 0x0}, - 92: {lang: 0x15d, script: 0x55, flags: 0x0}, - 93: {lang: 0x444, script: 0x5, flags: 0x0}, -} - -type likelyTag struct { - lang uint16 - region uint16 - script uint8 -} - -// Size: 198 bytes, 33 elements -var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x138, region: 0xd6, script: 0x55}, - 2: {lang: 0x138, region: 0x135, script: 0x55}, - 3: {lang: 0x3be, region: 0x41, script: 0x55}, - 4: {lang: 0x138, region: 0x2f, script: 0x55}, - 5: {lang: 0x138, region: 0xd6, script: 0x55}, - 6: {lang: 0x13d, region: 0xcf, script: 0x55}, - 7: {lang: 0x443, region: 0x12f, script: 0x55}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x443, region: 0x4b, script: 0x55}, - 10: {lang: 0x138, region: 0x161, script: 0x55}, - 11: {lang: 0x138, region: 0x135, script: 0x55}, - 12: {lang: 0x138, region: 0x135, script: 0x55}, - 13: {lang: 0x13d, region: 0x59, script: 0x55}, - 14: {lang: 0x527, region: 0x53, script: 0x37}, - 15: {lang: 0x1bc, region: 0x99, script: 0x20}, - 16: {lang: 0x1df, region: 0x95, script: 0x55}, - 17: {lang: 0x1f7, region: 0x9e, script: 0x55}, - 18: {lang: 0x138, region: 0x2f, script: 0x55}, - 19: {lang: 0x138, region: 0xe6, script: 0x55}, - 20: {lang: 0x138, region: 0x8a, script: 0x55}, - 21: {lang: 0x419, region: 0x142, script: 0x55}, - 22: {lang: 0x527, region: 0x53, script: 0x37}, - 23: {lang: 0x4ba, region: 0x137, script: 0x55}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e0, region: 0x106, script: 0x1e}, - 26: {lang: 0x3e0, region: 0x106, script: 0x1e}, - 27: {lang: 0x138, region: 0x7b, script: 0x55}, - 28: {lang: 0x10c, region: 0x60, script: 0x55}, - 30: {lang: 0x13d, region: 0x1f, script: 0x55}, - 31: {lang: 0x138, region: 0x9a, script: 0x55}, - 32: {lang: 0x138, region: 0x7b, script: 0x55}, -} - -// Size: 358 bytes, 358 elements -var regionToGroups = [358]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, - // Entry 40 - 7F - 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, - 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - // Entry 80 - BF - 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, - // Entry C0 - FF - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, - 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 100 - 13F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, - // Entry 140 - 17F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} - -// Size: 18 bytes, 3 elements -var paradigmLocales = [3][3]uint16{ - 0: [3]uint16{0x138, 0x0, 0x7b}, - 1: [3]uint16{0x13d, 0x0, 0x1f}, - 2: [3]uint16{0x3be, 0x41, 0xee}, -} - -type mutualIntelligibility struct { - want uint16 - have uint16 - distance uint8 - oneway bool -} - -type scriptIntelligibility struct { - wantLang uint16 - haveLang uint16 - wantScript uint8 - haveScript uint8 - distance uint8 -} - -type regionIntelligibility struct { - lang uint16 - script uint8 - group uint8 - distance uint8 -} - -// matchLang holds pairs of langIDs of base languages that are typically -// mutually intelligible. Each pair is associated with a confidence and -// whether the intelligibility goes one or both ways. -// Size: 678 bytes, 113 elements -var matchLang = [113]mutualIntelligibility{ - 0: {want: 0x1cf, have: 0xb7, distance: 0x4, oneway: false}, - 1: {want: 0x405, have: 0xb7, distance: 0x4, oneway: false}, - 2: {want: 0x405, have: 0x1cf, distance: 0x4, oneway: false}, - 3: {want: 0x405, have: 0x430, distance: 0x4, oneway: false}, - 4: {want: 0x438, have: 0x1, distance: 0x4, oneway: false}, - 5: {want: 0x1a1, have: 0x10c, distance: 0x4, oneway: true}, - 6: {want: 0x293, have: 0x10c, distance: 0x4, oneway: true}, - 7: {want: 0x100, have: 0x36d, distance: 0x8, oneway: false}, - 8: {want: 0x100, have: 0x345, distance: 0x8, oneway: false}, - 9: {want: 0x5, have: 0x3e0, distance: 0xa, oneway: true}, - 10: {want: 0xd, have: 0x138, distance: 0xa, oneway: true}, - 11: {want: 0x16, have: 0x365, distance: 0xa, oneway: true}, - 12: {want: 0x21, have: 0x138, distance: 0xa, oneway: true}, - 13: {want: 0x56, have: 0x13d, distance: 0xa, oneway: true}, - 14: {want: 0x58, have: 0x3e0, distance: 0xa, oneway: true}, - 15: {want: 0x71, have: 0x3e0, distance: 0xa, oneway: true}, - 16: {want: 0x75, have: 0x138, distance: 0xa, oneway: true}, - 17: {want: 0x82, have: 0x1bc, distance: 0xa, oneway: true}, - 18: {want: 0xa5, have: 0x138, distance: 0xa, oneway: true}, - 19: {want: 0xb2, have: 0x15d, distance: 0xa, oneway: true}, - 20: {want: 0xdd, have: 0x152, distance: 0xa, oneway: true}, - 21: {want: 0xe5, have: 0x138, distance: 0xa, oneway: true}, - 22: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, - 23: {want: 0xef, have: 0x15d, distance: 0xa, oneway: true}, - 24: {want: 0xf8, have: 0x15d, distance: 0xa, oneway: true}, - 25: {want: 0xff, have: 0x138, distance: 0xa, oneway: true}, - 26: {want: 0x12f, have: 0x138, distance: 0xa, oneway: true}, - 27: {want: 0x13b, have: 0x138, distance: 0xa, oneway: true}, - 28: {want: 0x13f, have: 0x150, distance: 0xa, oneway: true}, - 29: {want: 0x144, have: 0x13d, distance: 0xa, oneway: true}, - 30: {want: 0x157, have: 0x100, distance: 0xa, oneway: true}, - 31: {want: 0x16c, have: 0x365, distance: 0xa, oneway: true}, - 32: {want: 0x16d, have: 0x138, distance: 0xa, oneway: true}, - 33: {want: 0x16e, have: 0x138, distance: 0xa, oneway: true}, - 34: {want: 0x17c, have: 0x138, distance: 0xa, oneway: true}, - 35: {want: 0x18e, have: 0x13d, distance: 0xa, oneway: true}, - 36: {want: 0x192, have: 0x13d, distance: 0xa, oneway: true}, - 37: {want: 0x1a2, have: 0x1bc, distance: 0xa, oneway: true}, - 38: {want: 0x1b2, have: 0x138, distance: 0xa, oneway: true}, - 39: {want: 0x1b6, have: 0x138, distance: 0xa, oneway: true}, - 40: {want: 0x1d2, have: 0x15d, distance: 0xa, oneway: true}, - 41: {want: 0x1d5, have: 0x3e0, distance: 0xa, oneway: true}, - 42: {want: 0x1d7, have: 0x138, distance: 0xa, oneway: true}, - 43: {want: 0x1e5, have: 0x138, distance: 0xa, oneway: true}, - 44: {want: 0x1f6, have: 0x138, distance: 0xa, oneway: true}, - 45: {want: 0x20c, have: 0x1df, distance: 0xa, oneway: true}, - 46: {want: 0x20e, have: 0x138, distance: 0xa, oneway: true}, - 47: {want: 0x22b, have: 0x15d, distance: 0xa, oneway: true}, - 48: {want: 0x240, have: 0x3e0, distance: 0xa, oneway: true}, - 49: {want: 0x248, have: 0x138, distance: 0xa, oneway: true}, - 50: {want: 0x24f, have: 0x138, distance: 0xa, oneway: true}, - 51: {want: 0x263, have: 0x138, distance: 0xa, oneway: true}, - 52: {want: 0x272, have: 0x488, distance: 0xa, oneway: true}, - 53: {want: 0x288, have: 0x3e0, distance: 0xa, oneway: true}, - 54: {want: 0x28c, have: 0x1f7, distance: 0xa, oneway: true}, - 55: {want: 0x2a1, have: 0x138, distance: 0xa, oneway: true}, - 56: {want: 0x2b3, have: 0x15d, distance: 0xa, oneway: true}, - 57: {want: 0x2b6, have: 0x138, distance: 0xa, oneway: true}, - 58: {want: 0x2bc, have: 0x138, distance: 0xa, oneway: true}, - 59: {want: 0x2c1, have: 0x15d, distance: 0xa, oneway: true}, - 60: {want: 0x2eb, have: 0x138, distance: 0xa, oneway: true}, - 61: {want: 0x2ef, have: 0x15d, distance: 0xa, oneway: true}, - 62: {want: 0x2f8, have: 0x138, distance: 0xa, oneway: true}, - 63: {want: 0x2fd, have: 0x7e, distance: 0xa, oneway: true}, - 64: {want: 0x302, have: 0x138, distance: 0xa, oneway: true}, - 65: {want: 0x309, have: 0x3e0, distance: 0xa, oneway: true}, - 66: {want: 0x319, have: 0x1bc, distance: 0xa, oneway: true}, - 67: {want: 0x31d, have: 0x1df, distance: 0xa, oneway: true}, - 68: {want: 0x31e, have: 0x138, distance: 0xa, oneway: true}, - 69: {want: 0x32f, have: 0x138, distance: 0xa, oneway: true}, - 70: {want: 0x34f, have: 0x138, distance: 0xa, oneway: true}, - 71: {want: 0x368, have: 0x345, distance: 0xa, oneway: false}, - 72: {want: 0x368, have: 0x36d, distance: 0xa, oneway: true}, - 73: {want: 0x378, have: 0x138, distance: 0xa, oneway: true}, - 74: {want: 0x385, have: 0x138, distance: 0xa, oneway: true}, - 75: {want: 0x387, have: 0x138, distance: 0xa, oneway: true}, - 76: {want: 0x389, have: 0x15d, distance: 0xa, oneway: true}, - 77: {want: 0x38e, have: 0x138, distance: 0xa, oneway: true}, - 78: {want: 0x393, have: 0x138, distance: 0xa, oneway: true}, - 79: {want: 0x39b, have: 0x138, distance: 0xa, oneway: true}, - 80: {want: 0x3a3, have: 0x138, distance: 0xa, oneway: true}, - 81: {want: 0x3bc, have: 0x138, distance: 0xa, oneway: true}, - 82: {want: 0x3c2, have: 0x13d, distance: 0xa, oneway: true}, - 83: {want: 0x3d2, have: 0x10c, distance: 0xa, oneway: true}, - 84: {want: 0x3d7, have: 0x138, distance: 0xa, oneway: true}, - 85: {want: 0x3e3, have: 0x15d, distance: 0xa, oneway: true}, - 86: {want: 0x3e7, have: 0x1bc, distance: 0xa, oneway: true}, - 87: {want: 0x3f8, have: 0x138, distance: 0xa, oneway: true}, - 88: {want: 0x40a, have: 0x138, distance: 0xa, oneway: true}, - 89: {want: 0x421, have: 0x138, distance: 0xa, oneway: true}, - 90: {want: 0x427, have: 0x138, distance: 0xa, oneway: true}, - 91: {want: 0x42f, have: 0x138, distance: 0xa, oneway: true}, - 92: {want: 0x439, have: 0x138, distance: 0xa, oneway: true}, - 93: {want: 0x43c, have: 0x1df, distance: 0xa, oneway: true}, - 94: {want: 0x443, have: 0x138, distance: 0xa, oneway: true}, - 95: {want: 0x44e, have: 0x138, distance: 0xa, oneway: true}, - 96: {want: 0x45f, have: 0x138, distance: 0xa, oneway: true}, - 97: {want: 0x465, have: 0x3e0, distance: 0xa, oneway: true}, - 98: {want: 0x46d, have: 0x138, distance: 0xa, oneway: true}, - 99: {want: 0x474, have: 0x3e0, distance: 0xa, oneway: true}, - 100: {want: 0x3880, have: 0x138, distance: 0xa, oneway: true}, - 101: {want: 0x47e, have: 0x138, distance: 0xa, oneway: true}, - 102: {want: 0x480, have: 0x138, distance: 0xa, oneway: true}, - 103: {want: 0x492, have: 0x3e0, distance: 0xa, oneway: true}, - 104: {want: 0x49b, have: 0x138, distance: 0xa, oneway: true}, - 105: {want: 0x4aa, have: 0x527, distance: 0xa, oneway: true}, - 106: {want: 0x4b2, have: 0x138, distance: 0xa, oneway: true}, - 107: {want: 0x4ba, have: 0x3e0, distance: 0xa, oneway: true}, - 108: {want: 0x4e3, have: 0x15d, distance: 0xa, oneway: true}, - 109: {want: 0x4f0, have: 0x138, distance: 0xa, oneway: true}, - 110: {want: 0x510, have: 0x138, distance: 0xa, oneway: true}, - 111: {want: 0x516, have: 0x138, distance: 0xa, oneway: true}, - 112: {want: 0x52c, have: 0x138, distance: 0xa, oneway: true}, -} - -// matchScript holds pairs of scriptIDs where readers of one script -// can typically also read the other. Each is associated with a confidence. -// Size: 208 bytes, 26 elements -var matchScript = [26]scriptIntelligibility{ - 0: {wantLang: 0x430, haveLang: 0x430, wantScript: 0x55, haveScript: 0x1e, distance: 0x5}, - 1: {wantLang: 0x430, haveLang: 0x430, wantScript: 0x1e, haveScript: 0x55, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e0, wantScript: 0x55, haveScript: 0x1e, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x138, wantScript: 0xe, haveScript: 0x55, distance: 0xa}, - 4: {wantLang: 0x1d5, haveLang: 0x3e0, wantScript: 0x8, haveScript: 0x1e, distance: 0xa}, - 5: {wantLang: 0x20e, haveLang: 0x138, wantScript: 0x2a, haveScript: 0x55, distance: 0xa}, - 6: {wantLang: 0x248, haveLang: 0x138, wantScript: 0x49, haveScript: 0x55, distance: 0xa}, - 7: {wantLang: 0x24f, haveLang: 0x138, wantScript: 0x4d, haveScript: 0x55, distance: 0xa}, - 8: {wantLang: 0x2b6, haveLang: 0x138, wantScript: 0x52, haveScript: 0x55, distance: 0xa}, - 9: {wantLang: 0x302, haveLang: 0x138, wantScript: 0x69, haveScript: 0x55, distance: 0xa}, - 10: {wantLang: 0x32f, haveLang: 0x138, wantScript: 0x70, haveScript: 0x55, distance: 0xa}, - 11: {wantLang: 0x34f, haveLang: 0x138, wantScript: 0x20, haveScript: 0x55, distance: 0xa}, - 12: {wantLang: 0x393, haveLang: 0x138, wantScript: 0x7a, haveScript: 0x55, distance: 0xa}, - 13: {wantLang: 0x39b, haveLang: 0x138, wantScript: 0x32, haveScript: 0x55, distance: 0xa}, - 14: {wantLang: 0x3bc, haveLang: 0x138, wantScript: 0x5, haveScript: 0x55, distance: 0xa}, - 15: {wantLang: 0x3f8, haveLang: 0x138, wantScript: 0x5, haveScript: 0x55, distance: 0xa}, - 16: {wantLang: 0x40a, haveLang: 0x138, wantScript: 0xc6, haveScript: 0x55, distance: 0xa}, - 17: {wantLang: 0x44e, haveLang: 0x138, wantScript: 0xd3, haveScript: 0x55, distance: 0xa}, - 18: {wantLang: 0x45f, haveLang: 0x138, wantScript: 0xd6, haveScript: 0x55, distance: 0xa}, - 19: {wantLang: 0x46d, haveLang: 0x138, wantScript: 0x28, haveScript: 0x55, distance: 0xa}, - 20: {wantLang: 0x474, haveLang: 0x3e0, wantScript: 0x55, haveScript: 0x1e, distance: 0xa}, - 21: {wantLang: 0x4b2, haveLang: 0x138, wantScript: 0x5, haveScript: 0x55, distance: 0xa}, - 22: {wantLang: 0x4ba, haveLang: 0x3e0, wantScript: 0x55, haveScript: 0x1e, distance: 0xa}, - 23: {wantLang: 0x510, haveLang: 0x138, wantScript: 0x3a, haveScript: 0x55, distance: 0xa}, - 24: {wantLang: 0x527, haveLang: 0x527, wantScript: 0x37, haveScript: 0x38, distance: 0xf}, - 25: {wantLang: 0x527, haveLang: 0x527, wantScript: 0x38, haveScript: 0x37, distance: 0x13}, -} - -// Size: 90 bytes, 15 elements -var matchRegion = [15]regionIntelligibility{ - 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, - 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, - 2: {lang: 0x138, script: 0x0, group: 0x1, distance: 0x4}, - 3: {lang: 0x138, script: 0x0, group: 0x81, distance: 0x4}, - 4: {lang: 0x13d, script: 0x0, group: 0x3, distance: 0x4}, - 5: {lang: 0x13d, script: 0x0, group: 0x83, distance: 0x4}, - 6: {lang: 0x3be, script: 0x0, group: 0x3, distance: 0x4}, - 7: {lang: 0x3be, script: 0x0, group: 0x83, distance: 0x4}, - 8: {lang: 0x527, script: 0x38, group: 0x2, distance: 0x4}, - 9: {lang: 0x527, script: 0x38, group: 0x82, distance: 0x4}, - 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5}, - 11: {lang: 0x138, script: 0x0, group: 0x80, distance: 0x5}, - 12: {lang: 0x13d, script: 0x0, group: 0x80, distance: 0x5}, - 13: {lang: 0x3be, script: 0x0, group: 0x80, distance: 0x5}, - 14: {lang: 0x527, script: 0x38, group: 0x80, distance: 0x5}, -} - -// Size: 264 bytes, 33 elements -var regionContainment = [33]uint64{ - // Entry 0 - 1F - 0x00000001dfffffff, 0x00000000000007a2, 0x0000000000003044, 0x0000000000000008, - 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, - 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, - 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, - 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, - 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, - 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, - 0x0000000010000000, 0x0000000020000000, 0x0000000040002048, 0x0000000080000000, - // Entry 20 - 3F - 0x0000000100000000, -} - -// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, -// where each set holds all groupings that are directly connected in a region -// containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, - 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, - 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, - 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, - 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, - 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, - 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, - 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, - // Entry 40 - 7F - 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, - 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, - // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, - // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, - // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, -} - -// regionInclusionBits is an array of bit vectors where every vector represents -// a set of region groupings. These sets are used to compute the distance -// between two regions for the purpose of language matching. -// Size: 584 bytes, 73 elements -var regionInclusionBits = [73]uint64{ - // Entry 0 - 1F - 0x0000000102400813, 0x00000000000007a3, 0x0000000000003844, 0x0000000040000808, - 0x00000000803c0011, 0x0000000000000022, 0x0000000040000844, 0x0000000000000082, - 0x0000000000000102, 0x0000000000000202, 0x0000000000000402, 0x000000004000384d, - 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, - 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, - 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, - 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, - 0x0000000012000000, 0x0000000020000000, 0x0000000040002848, 0x0000000080000010, - // Entry 20 - 3F - 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, - 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, - 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, - 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, - 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, - 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, - 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, - 0x0000000000100000, 0x0000000000800000, 0x00000001dfffffff, 0x0000000102400fb3, - // Entry 40 - 5F - 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, - 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, - 0x0000000102020001, -} - -// regionInclusionNext marks, for each entry in regionInclusionBits, the set of -// all groups that are reachable from the groups set in the respective entry. -// Size: 73 bytes, 73 elements -var regionInclusionNext = [73]uint8{ - // Entry 0 - 3F - 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, - 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, - 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, - 0x16, 0x43, 0x19, 0x19, 0x19, 0x1d, 0x0b, 0x04, - 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, - 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, - 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, - 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, - // Entry 40 - 7F - 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, - 0x43, -} - -type parentRel struct { - lang uint16 - script uint8 - maxScript uint8 - toRegion uint16 - fromRegion []uint16 -} - -// Size: 414 bytes, 5 elements -var parents = [5]parentRel{ - 0: {lang: 0x138, script: 0x0, maxScript: 0x55, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x138, script: 0x0, maxScript: 0x55, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13d, script: 0x0, maxScript: 0x55, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3be, script: 0x0, maxScript: 0x55, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x527, script: 0x38, maxScript: 0x38, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, -} - -// Total table size 27175 bytes (26KiB); checksum: 569649CD diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go deleted file mode 100644 index de30155..0000000 --- a/vendor/golang.org/x/text/language/tags.go +++ /dev/null @@ -1,143 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -// TODO: Various sets of commonly use tags and regions. - -// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. -// It simplifies safe initialization of Tag values. -func MustParse(s string) Tag { - t, err := Parse(s) - if err != nil { - panic(err) - } - return t -} - -// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. -// It simplifies safe initialization of Tag values. -func (c CanonType) MustParse(s string) Tag { - t, err := c.Parse(s) - if err != nil { - panic(err) - } - return t -} - -// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. -// It simplifies safe initialization of Base values. -func MustParseBase(s string) Base { - b, err := ParseBase(s) - if err != nil { - panic(err) - } - return b -} - -// MustParseScript is like ParseScript, but panics if the given script cannot be -// parsed. It simplifies safe initialization of Script values. -func MustParseScript(s string) Script { - scr, err := ParseScript(s) - if err != nil { - panic(err) - } - return scr -} - -// MustParseRegion is like ParseRegion, but panics if the given region cannot be -// parsed. It simplifies safe initialization of Region values. -func MustParseRegion(s string) Region { - r, err := ParseRegion(s) - if err != nil { - panic(err) - } - return r -} - -var ( - und = Tag{} - - Und Tag = Tag{} - - Afrikaans Tag = Tag{lang: _af} // af - Amharic Tag = Tag{lang: _am} // am - Arabic Tag = Tag{lang: _ar} // ar - ModernStandardArabic Tag = Tag{lang: _ar, region: _001} // ar-001 - Azerbaijani Tag = Tag{lang: _az} // az - Bulgarian Tag = Tag{lang: _bg} // bg - Bengali Tag = Tag{lang: _bn} // bn - Catalan Tag = Tag{lang: _ca} // ca - Czech Tag = Tag{lang: _cs} // cs - Danish Tag = Tag{lang: _da} // da - German Tag = Tag{lang: _de} // de - Greek Tag = Tag{lang: _el} // el - English Tag = Tag{lang: _en} // en - AmericanEnglish Tag = Tag{lang: _en, region: _US} // en-US - BritishEnglish Tag = Tag{lang: _en, region: _GB} // en-GB - Spanish Tag = Tag{lang: _es} // es - EuropeanSpanish Tag = Tag{lang: _es, region: _ES} // es-ES - LatinAmericanSpanish Tag = Tag{lang: _es, region: _419} // es-419 - Estonian Tag = Tag{lang: _et} // et - Persian Tag = Tag{lang: _fa} // fa - Finnish Tag = Tag{lang: _fi} // fi - Filipino Tag = Tag{lang: _fil} // fil - French Tag = Tag{lang: _fr} // fr - CanadianFrench Tag = Tag{lang: _fr, region: _CA} // fr-CA - Gujarati Tag = Tag{lang: _gu} // gu - Hebrew Tag = Tag{lang: _he} // he - Hindi Tag = Tag{lang: _hi} // hi - Croatian Tag = Tag{lang: _hr} // hr - Hungarian Tag = Tag{lang: _hu} // hu - Armenian Tag = Tag{lang: _hy} // hy - Indonesian Tag = Tag{lang: _id} // id - Icelandic Tag = Tag{lang: _is} // is - Italian Tag = Tag{lang: _it} // it - Japanese Tag = Tag{lang: _ja} // ja - Georgian Tag = Tag{lang: _ka} // ka - Kazakh Tag = Tag{lang: _kk} // kk - Khmer Tag = Tag{lang: _km} // km - Kannada Tag = Tag{lang: _kn} // kn - Korean Tag = Tag{lang: _ko} // ko - Kirghiz Tag = Tag{lang: _ky} // ky - Lao Tag = Tag{lang: _lo} // lo - Lithuanian Tag = Tag{lang: _lt} // lt - Latvian Tag = Tag{lang: _lv} // lv - Macedonian Tag = Tag{lang: _mk} // mk - Malayalam Tag = Tag{lang: _ml} // ml - Mongolian Tag = Tag{lang: _mn} // mn - Marathi Tag = Tag{lang: _mr} // mr - Malay Tag = Tag{lang: _ms} // ms - Burmese Tag = Tag{lang: _my} // my - Nepali Tag = Tag{lang: _ne} // ne - Dutch Tag = Tag{lang: _nl} // nl - Norwegian Tag = Tag{lang: _no} // no - Punjabi Tag = Tag{lang: _pa} // pa - Polish Tag = Tag{lang: _pl} // pl - Portuguese Tag = Tag{lang: _pt} // pt - BrazilianPortuguese Tag = Tag{lang: _pt, region: _BR} // pt-BR - EuropeanPortuguese Tag = Tag{lang: _pt, region: _PT} // pt-PT - Romanian Tag = Tag{lang: _ro} // ro - Russian Tag = Tag{lang: _ru} // ru - Sinhala Tag = Tag{lang: _si} // si - Slovak Tag = Tag{lang: _sk} // sk - Slovenian Tag = Tag{lang: _sl} // sl - Albanian Tag = Tag{lang: _sq} // sq - Serbian Tag = Tag{lang: _sr} // sr - SerbianLatin Tag = Tag{lang: _sr, script: _Latn} // sr-Latn - Swedish Tag = Tag{lang: _sv} // sv - Swahili Tag = Tag{lang: _sw} // sw - Tamil Tag = Tag{lang: _ta} // ta - Telugu Tag = Tag{lang: _te} // te - Thai Tag = Tag{lang: _th} // th - Turkish Tag = Tag{lang: _tr} // tr - Ukrainian Tag = Tag{lang: _uk} // uk - Urdu Tag = Tag{lang: _ur} // ur - Uzbek Tag = Tag{lang: _uz} // uz - Vietnamese Tag = Tag{lang: _vi} // vi - Chinese Tag = Tag{lang: _zh} // zh - SimplifiedChinese Tag = Tag{lang: _zh, script: _Hans} // zh-Hans - TraditionalChinese Tag = Tag{lang: _zh, script: _Hant} // zh-Hant - Zulu Tag = Tag{lang: _zu} // zu -) |